KEGG   Mycobacterium canettii CIPT 140010059: MCAN_04891Help
Entry
MCAN_04891        CDS       T01585                                 

Gene name
gpm1
Definition
(GenBank) putative phosphoglycerate mutase 1 GPM1 (phosphoglyceromutase) (PGAM) (BPG-dependent PGAM)
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00010  Glycolysis / Gluconeogenesis
mce00260  Glycine, serine and threonine metabolism
mce00680  Methane metabolism
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01120  Microbial metabolism in diverse environments
mce01130  Biosynthesis of antibiotics
mce01200  Carbon metabolism
mce01230  Biosynthesis of amino acids
Module
mce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mce_M00002  Glycolysis, core module involving three-carbon compounds
mce_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCAN_04891 (gpm1)
  Energy metabolism
   00680 Methane metabolism
    MCAN_04891 (gpm1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCAN_04891 (gpm1)
Enzymes [BR:mce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MCAN_04891 (gpm1)
Membrane trafficking [BR:mce04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MCAN_04891 (gpm1)
Exosome [BR:mce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MCAN_04891 (gpm1)
  Exosomal proteins of melanoma cells
   MCAN_04891 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCC42829
UniProt: G0TPJ6
Position
588708..589457
Genome map
AA seq 249 aa AA seqDB search
MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLRVGKTVLI
VAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacactggcagcctggtgttgctgcgccacggcgagagcgactggaatgccctc
aacctgttcaccggctgggtcgatgtcggcctgacggacaagggccaggcagaggcggtt
cgaagcggcgagctgatcgcggaacacgacctattgcccgacgtgctctacacctcgttg
ctgcggcgcgcgatcaccaccgcgcatctggcgttggacagcgccgatcggctctggatt
cccgtgcggcgtagctggcggctcaacgaacgccactacggcgcgctgcagggtttggac
aaggccgagaccaaggcccgctatggcgaagagcagttcatggcctggcggcgcagctat
gacacgccgccgccgccgatcgagcggggcagtcagttcagccaggacgccgaccctcgt
tacgccgacatcggcggtggcccgctcaccgaatgtctggctgacgtggtcgcccggttt
ttgccatatttcaccgacgtcatcgttggcgacttgcgggtcggcaagacggtgctgatc
gttgcccacggcaactcgttgcgcgcgctggtcaagcacctggaccagatgtctgacgac
gaaatcgtcggactgaacatcccgaccggaattccgctgcgctacgacctggattccgcg
atgaggccgctggtgcgcggtggtacgtatctggacccggaggcggcagccgccggcgcc
gccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system