KEGG   Mycobacterium canettii CIPT 140010059: MCAN_09051Help
Entry
MCAN_09051        CDS       T01585                                 

Gene name
echA6
Definition
putative enoyl-CoA hydratase ECHA6
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MCAN_09051 (echA6)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MCAN_09051 (echA6)
   00650 Butanoate metabolism
    MCAN_09051 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    MCAN_09051 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCAN_09051 (echA6)
   00310 Lysine degradation
    MCAN_09051 (echA6)
   00360 Phenylalanine metabolism
    MCAN_09051 (echA6)
   00380 Tryptophan metabolism
    MCAN_09051 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCAN_09051 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCAN_09051 (echA6)
   00281 Geraniol degradation
    MCAN_09051 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCAN_09051 (echA6)
   00627 Aminobenzoate degradation
    MCAN_09051 (echA6)
   00930 Caprolactam degradation
    MCAN_09051 (echA6)
Enzymes [BR:mce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCAN_09051 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1013313..1014044
Genome map
AA seq 243 aa AA seqDB search
MIGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGTAFCAGA
DLSGDAFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQ
FPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLVDAQAW
AAEIARLAPLAIQHAKRVLNDDGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF
QGA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtatcacccaggcagaagccgtgctgaccattgagctgcaacgcccggagcgc
cgcaacgcgttaaattcccagctggtcgaggagcttacgcaggccatccggaaagccggg
gatggatcggctcgggcgatcgtgctgaccggccaaggcaccgcgttctgcgctggcgcg
gacctgagcggagacgcattcgccgccgattatcccgaccggctcatcgagctgcacaag
gcgatggacgcctccccgatgccagtggtcggcgcgatcaacggtcccgccatcggcgcc
ggcttgcagcttgccatgcaatgcgacctgcgggttgtcgcgcccgatgccttcttccag
tttccgacgtcgaaatacggtctggccctggataactggagcatccgccggctgtcgtcg
ttggttgggcacggacgtgcccgcgcgatgctgctcagcgcggaaaagctgaccgccgag
atcgcactgcacaccggaatggcgaatcgcattggcactttggtcgacgcccaggcctgg
gccgccgagatcgccaggctggcaccactggctatccagcacgccaagcgggtgctcaac
gacgacggcgctatcgaggaagcgtggccggcccataaggaactcttcgacaaagcctgg
ggcagccaggatgtcatcgaagcgcaggttgccaggatggaaaagcggccgccgaagttc
caaggggcttaa

DBGET integrated database retrieval system