KEGG   Mycobacterium canettii CIPT 140010059: MCAN_09551Help
Entry
MCAN_09551        CDS       T01585                                 

Gene name
sucC
Definition
(GenBank) putative succinyl-CoA synthetase (beta chain) SUCC (SCS-beta)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00020  Citrate cycle (TCA cycle)
mce00640  Propanoate metabolism
mce00660  C5-Branched dibasic acid metabolism
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01120  Microbial metabolism in diverse environments
mce01130  Biosynthesis of antibiotics
mce01200  Carbon metabolism
Module
mce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCAN_09551 (sucC)
   00640 Propanoate metabolism
    MCAN_09551 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MCAN_09551 (sucC)
Enzymes [BR:mce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MCAN_09551 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A Baculo_E25
Motif
Other DBs
NCBI-ProteinID: CCC43292
UniProt: G0TFU9
Position
1072184..1073347
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPSTPGRVTDTAEGAKAIATEIGRPVMVKAQVKIGGRGKAGGVK
YAATPQDAYEHAKNILGLDIKGHIVKKLLVAEASDIAEEYYLSFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVNAVKGVDLDFARSIAEQGHLPAEVLDTAAVTIAKLWELF
VAEDATLVEVNPLVRTPDHKILALDAKITLDGNADFRQPGHAEFEDRAATDPLELKAKEH
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VVLGDQQVKSVFVNVFGGITSCDAVATGIVKALGMLGDEANKPLVVRLDGNNVEEGRRIL
TEANHPLVTLVATMDEAADKAAELASA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttcgagtatcaagccaaggagttattcgccaagcacaacgtgcccagcacg
ccgggtcgggtgaccgacacagccgagggtgccaaggctatcgccacggagatcgggcgt
ccggtgatggtcaaagcgcaggtcaagatcggcggccggggcaaggccggtggcgtcaaa
tacgccgcgaccccacaagacgcgtacgagcacgccaagaacatcctcggcctggacatc
aaaggacacatcgtcaagaaactgctggtcgctgaggctagcgatatcgccgaggagtac
tacctatccttcctgctcgaccgggccaaccgcacctacctggcgatgtgctcggtggag
ggcggcatggagatcgaagaggtagcggccaccaaacccgagcggctcgccaaagtcccg
gtgaatgccgtcaagggcgttgacctagatttcgcgcggtccatcgccgaacagggtcat
cttccggccgaggtgctcgacaccgcagcggtcaccatcgccaagctgtgggagctcttc
gtcgccgaggacgcgacgctggttgaggtcaacccgttggtgcggacgcctgaccacaag
atcctcgcgctggatgccaagatcaccctcgacggcaacgccgatttccgtcagcctggc
catgccgagttcgaggatcgagctgccaccgatccactggagttgaaggccaaggagcac
gacctcaactacgtcaagctggacggtcaggtggggatcatcggcaatggcgcgggcttg
gtgatgtcgactctcgacgtcgtcgcgtatgccggtgagaagcacggcggagtcaagccg
gccaacttcctggatatcggcggcggcgcttcggccgaggtgatggccgcgggtctggac
gtggtgctgggcgaccagcaggtcaagagcgtgttcgtcaacgtcttcggtggcatcacc
tcgtgcgatgcggtggcgaccgggatcgtcaaggcgctgggcatgctgggtgacgaagcc
aacaagccgctggtggttcggctcgacggcaacaacgtcgaggaaggccgtcgcatcctg
accgaggccaaccaccccctggtgacactggtggcgacgatggacgaagccgccgacaag
gccgctgagctggcgagcgcctga

DBGET integrated database retrieval system