KEGG   Mycobacterium canettii CIPT 140010059: MCAN_09981Help
Entry
MCAN_09981        CDS       T01585                                 

Gene name
galU
Definition
putative UTP--glucose-1-phosphate uridylyltransferase GALU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MCAN_09981 (galU)
   00052 Galactose metabolism
    MCAN_09981 (galU)
   00500 Starch and sucrose metabolism
    MCAN_09981 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MCAN_09981 (galU)
Enzymes [BR:mce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MCAN_09981 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1120079..1120999
Genome map
AA seq 306 aa AA seqDB search
MSRPEVLTPFTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAAAGAERLVI
VTSEGKDGVVAHFVEDLVLEGTLEARGKIAMLAKVRRAPALIKVESVVQAEPLGLGHAIG
CVEPTLSPDEDAVAVLLPDDLVLPTGVLETMSKVRASRGGTVLCAIEVAREEISAYGVFD
VEPVPDGDYTDDPNVLKVRGMVEKPKAETAPSRYAAAGRYVLDRAIFDALRRIDRGAGGE
VQLTDAIALLIAEGHPVHVVVHQGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVAR
LGLTEQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcccagaagtactaacgccgttcacggcaatcgtcccggcagccggcctgggt
acgcgctttctgccggccaccaagacggtgcccaaggagctgctgcccgtcgtcgacact
cccggtatcgagctggtggccgccgaggcggccgcggccggtgccgaacggctggtgatc
gtcacctccgagggtaaggacggggtggtcgcgcatttcgtggaagacctggtgctggag
ggcacgctcgaggcccgaggcaagatcgccatgctggccaaggtgcgtcgcgccccggca
ctgatcaaggtcgaatccgtggtgcaggccgagccgctgggactgggacacgccatcggc
tgtgtggagccgacgctgtcgcccgacgaagacgctgtcgcggtgctgctgcctgacgac
ctggtgctgccgaccggcgtcctggagacgatgtcgaaggtgcgagccagcaggggcggc
accgtgctgtgtgctatcgaggtggcgcgcgaggagatcagtgcctacggggttttcgat
gtcgagccggtccccgatggtgactacaccgacgatcccaacgtgctgaaggtcaggggc
atggtcgaaaagcccaaggccgaaacggcgccgtcgaggtatgcggcggccggccgctac
gttctagaccgtgccatcttcgatgcgttacgccgcatcgaccggggtgcaggcggtgaa
gtgcagctcaccgatgcgatcgcgctgctgattgccgagggccatcccgtccatgtcgtc
gtccaccaagggtcccgacacgacctgggaaatccgggcgggtacctcaaggctgcggtt
gactttgcattggatcgtgacgactacggcccggacttgcggcgatggttggtggcgcga
ctgggtctgacagagcagtag

DBGET integrated database retrieval system