KEGG   Mycobacterium canettii CIPT 140010059: MCAN_11461Help
Entry
MCAN_11461        CDS       T01585                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase (acetoacetyl-CoA thiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCAN_11461
   00630 Glyoxylate and dicarboxylate metabolism
    MCAN_11461
   00640 Propanoate metabolism
    MCAN_11461
   00650 Butanoate metabolism
    MCAN_11461
  Lipid metabolism
   00071 Fatty acid degradation
    MCAN_11461
   00072 Synthesis and degradation of ketone bodies
    MCAN_11461
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCAN_11461
   00310 Lysine degradation
    MCAN_11461
   00380 Tryptophan metabolism
    MCAN_11461
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCAN_11461
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCAN_11461
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MCAN_11461
Enzymes [BR:mce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MCAN_11461
Exosome [BR:mce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCAN_11461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1284081..>1284323
Genome map
AA seq 81 aa AA seqDB search
MQLGNQNTMRFAGRPQRFRQSAYPLFNPNSAIALGHPFGGSAARLMTTVLHHMPDKGIRY
GLQTMCEGRGQAKCRHCGVAV
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggcaatcaaaacactatgagattcgcagggcggcctcagcgttttcgccaa
agcgcttaccccctgttcaaccccaacagcgcgatcgcgcttggccacccattcggcggc
tcggcggcacggttgatgactacagtgctacaccacatgccggacaagggaattcgctac
ggcttacagacgatgtgcgagggccgcggccaagccaaatgccgccattgtggagttgct
gtg

DBGET integrated database retrieval system