KEGG   Mycobacterium canettii CIPT 140010059: MCAN_12171Help
Entry
MCAN_12171        CDS       T01585                                 

Gene name
dapE
Definition
(GenBank) putative succinyl-diaminopimelate desuccinylase DAPE
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00300  Lysine biosynthesis
mce01100  Metabolic pathways
mce01120  Microbial metabolism in diverse environments
mce01230  Biosynthesis of amino acids
Module
mce_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MCAN_12171 (dapE)
Enzymes [BR:mce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MCAN_12171 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CCC43549
UniProt: G0TH96
Position
1365316..1366380
Genome map
AA seq 354 aa AA seqDB search
MLDLRGDPIELTAALIDIPSESRNEARIADEVEAALRAQASGFEIIRNGNAVLARTKLNR
SSRVLLAGHLDTVPVAGNLPSRRENDQLHGCGAADMKSGDAVFLHLAATLAEPTHDLTLV
FYDCEEIDSAANGLGRIQRELPDWLSADVAILGEPTAGCIEAGCQGTLRVVLSVTGTRAH
SARSWLGDNAIHKLGAVLDRLAVYRARSVDIDGCTYREGLSAVRVAGGVAGNVIPDAASV
TINYRFAPDRSVAAALQHVHDVFDGLDVQIEQTDAAAGALPGLSEPAAKALVEAAGGQVR
AKYGWTDVSRFAALGIPAVNYGPGDPNLAHCRDERVPVGNITAAVDLLRRYLGG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgctggatttgcgcggggacccgatcgaattgaccgcggcgctgattgacatccccagc
gagtcgaggaatgaggcacgcatcgccgacgaggtggaagcggcgttgcgcgctcaggca
tcggggttcgagatcatccgcaacggcaacgcggtgctggcgcgtacaaagctgaaccgg
tcctcgcgggtgctgttggccggacacctggacaccgtgccagtggccggcaacctgcct
agccgccgcgagaacgaccagctgcacggctgcggcgcagccgacatgaaatccggcgac
gcggtcttccttcatctggccgctacactggccgaaccgacgcacgatctaacactggtg
ttctacgactgcgaggaaatcgattcggcggcaaacggtttaggccgcatccagcgcgag
ctgccggactggctatccgcggatgtagccatcttgggtgagcccaccgccggctgcatc
gaggctggttgccagggcacgttgcgtgtcgtcctcagcgtgaccggaactcgcgcgcat
tcagcgcgttcgtggttgggtgacaacgcaatccacaagttgggtgctgtgctggaccgg
ttggccgtctaccgggcacgcagcgtcgacatcgacggttgcacctatcgggagggcctc
tcggcggtgcgcgtagcaggcggcgtcgccggcaacgtgatccccgacgcggcctcggtc
acgatcaactaccgctttgcccccgaccggtcggtggccgcggcattgcaacatgtccat
gacgtgttcgacgggctcgacgtgcagatcgagcagacggacgccgcggccggtgcgctg
cctggcctgtccgagcccgcggccaaggcgctggtcgaggccgccggcgggcaggtccgg
gccaagtatggctggactgatgtgtcgcgctttgccgctttgggcataccggcggtcaat
tacggcccgggtgatcccaacctggcgcactgccgcgacgaacgggtgcccgtcggcaac
atcaccgcggccgtggacttgctgcgccgatacctgggtggctag

DBGET integrated database retrieval system