KEGG   Mycobacterium canettii CIPT 140010059: MCAN_12211Help
Entry
MCAN_12211        CDS       T01585                                 

Gene name
folP2
Definition
putative dihydropteroate synthase 2 FOLP2
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MCAN_12211 (folP2)
Enzymes [BR:mce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MCAN_12211 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1371247..1372203
Genome map
AA seq 318 aa AA seqDB search
MRSTPPASAGRSTPPALAGHSTPPALAGHSTLCGRPVAGDRALIMAIVNRTPDSFYDKGA
TFSDAAARDAVHRAVADGADVIDVGGVKAGPGERVDVDTEITRLVPFIEWLRGAYPDQLI
SVDTWRAQVAKAACAAGADLINDTWGGVDPAMPEVAAEFGAGLVCAHTGGALPRTRPFRV
SYGTTTRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGKNTFHGLLLLRHVADLV
MTGWPVLMALSNKDVVGETLGVDLTERLEGTLAATALAAAAGARMFRVHEVAATRRVLEM
VASIQGVRPPTRTVRGLA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttcaacaccgccggcctcagccggtcgttcaacaccgccggcgttagccggccat
tcaacaccgccggcgttagccggccattcaacgctgtgcggccgtccagtcgcaggtgat
cgtgcgctgatcatggcgatcgtcaaccgcaccccggattcgttttacgacaagggtgcg
actttcagcgacgcggctgccagagacgcggtccaccgggccgtcgccgacggtgccgac
gtcatcgacgtcggcggtgtcaaagccggcccgggtgaacgcgtcgacgtcgacaccgag
atcacgcggctggtgccgttcatcgaatggctccgcggtgcttacccggaccagctgatc
agtgtcgacacctggcgcgcgcaggtggcgaaggcggcctgcgcggcgggtgcggacctg
atcaacgacacctggggtggcgtcgacccggccatgcccgaggtggccgccgagttcggc
gcgggcctggtgtgtgcgcacaccggcggcgcgctgccacgcacgcgacccttccgggtg
agctacggtacgactacccgcggtgtggtggatgctgtgattagccaggtcacagccgcc
gccgagcgggccgtcgcggccggggtggcccgcgagaaggtgttgatcgacccggcacac
gacttcggcaagaacaccttccatgggctgctgctattgcgacacgtggccgatcttgtt
atgaccgggtggcccgtgctgatggctttgagcaacaaggacgttgtcggggagactctg
ggcgtggatttgaccgaacggcttgagggaacgctggcagccaccgcgttggctgcggcc
gccggggcgcgcatgtttcgggtgcatgaggtcgccgccacccggcgggtgctggaaatg
gtggcatcgattcagggggtccggccgccgacgcgcacggtgagaggactcgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system