KEGG   Mycobacterium canettii CIPT 140010059: MCAN_13961Help
Entry
MCAN_13961        CDS       T01585                                 

Gene name
pyrB
Definition
putative aspartate carbamoyltransferase PYRB
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mce00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mce00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1576573..1577532
Genome map
AA seq 319 aa AA seqDB search
MTPRHLLTAADLSRDDATAILDDADRFAQALVGRDIKKLPTLRGRTVVTMFYENSTRTRV
SFEVAGKWMSADVINVSAAGSSVGKGESLRDTALTLRAAGADALIIRHPASGAAHLLAQW
TGANNDGPAVINAGDGTHEHPTQALLDALTIRQRLGGIEGRRIVIVGDILHSRVARSNVM
LLDTLGAEVVLVAPPTLLPVGVTGWPATVSHDFDAELPAADAVLMLRVQAERMNGGFFPS
VREYSVRYGLTERRQAMLPGHAVVLHPGPMVRGMEITSSVADSSQSAVLQQVSNGVQVRM
AVLFHVLVGAQDAGKEGAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaaggcacctgctgaccgccgccgacctcagccgcgacgacgccaccgccatc
ctcgacgacgccgaccggtttgcgcaggcgctggtcggtcgcgacatcaagaagctgccg
acgctgcggggccggaccgtcgtcacgatgttctatgagaactccacccgcacccgggtg
tcgttcgaggtagcgggtaagtggatgagcgccgacgtgatcaacgtcagcgctgccgga
tcttcggtaggcaagggtgagtcgctgcgggataccgcgctgaccctgcgcgcggccggg
gctgacgcgctgatcatccgccatcccgcgtccggcgccgcccatctgctggcgcagtgg
accggcgccaacaacgatgggccggcggtgatcaacgccggtgacggcactcatgaacac
cccacgcaggcgctgcttgatgcgctgaccatccgtcagcgcctcggcggcatcgaaggc
cggcgcatcgtgatcgtcggcgacatcctgcacagccgggtcgcccgctccaacgtcatg
ctgctggacaccctgggcgccgaggtggtgctggtggcgccacccacattgctaccggtc
ggggtgaccggctggccggccaccgtctcccacgacttcgatgccgagctgcccgccgcc
gacgcggtattgatgctgcgggtacaggccgagcggatgaacggcggttttttcccgtcc
gtacgggagtactcggtccgctacgggctaaccgagcggcgccaggcgatgcttcccggc
cacgccgtggtgttgcacccgggaccgatggtgcgtggcatggagatcacatcttcggtc
gcggactcgtcgcaatcggctgtgctgcaacaggtttccaacggagtccaggtgcggatg
gcggtgctgttccatgtgctggtgggagcgcaggatgccggtaaagagggtgcggcgtga

DBGET integrated database retrieval system