KEGG   Mycobacterium canettii CIPT 140010059: MCAN_14541Help
Entry
MCAN_14541        CDS       T01585                                 

Gene name
tpi
Definition
(RefSeq) putative triosephosphate isomerase TPI
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCAN_14541 (tpi)
   01230 Biosynthesis of amino acids
    MCAN_14541 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCAN_14541 (tpi)
   00051 Fructose and mannose metabolism
    MCAN_14541 (tpi)
   00562 Inositol phosphate metabolism
    MCAN_14541 (tpi)
Enzymes [BR:mce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MCAN_14541 (tpi)
Exosome [BR:mce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MCAN_14541 (tpi)
  Exosomal proteins of bladder cancer cells
   MCAN_14541 (tpi)
  Exosomal proteins of melanoma cells
   MCAN_14541 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1638835..1639620
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGD
KLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAAT
ALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTG
RVARAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG
ASLDGEQFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgctgatagccggcaactggaagatgaacctcaaccactacgaggcg
atcgcgctggtgcaaaagatcgcgttctcgttgccggacaagtattacgaccgggttgac
gtcgcggtgatcccgccgtttaccgacctgcgcagcgtgcaaaccctggtcgacggcgac
aagctgcggttgacctatggtgcacaagacttgtcaccacatgactccggcgcctatacg
ggtgacgtcagcggcgcctttctggccaagctggggtgcagttacgttgtcgtcgggcac
tccgagcggcgcacctatcacaacgaggatgacgcgctggtggccgccaaagccgccacc
gcactcaagcatggcctgaccccaatcgtgtgtattggcgagcacctcgacgtccgcgag
gcgggaaatcatgtggcccacaacatcgaacagttgcgtggatcgctggccgggctattg
gccgagcagatcggcagcgtcgtcatcgcctacgaaccggtctgggcgatcggcaccggg
cgggtggcccgcgccgccgacgcgcaggaggtgtgtgcggcgatccgaaaagagttggcc
tcgttggcctcgccgaggattgccgatacggtgcgggtgctctacggcggctcggtgaac
gccaaaaacgtcggcgacatcgtggcccaggacgacgtcgacggtggcctggtcggcggg
gcgtcgctggacggggagcagttcgcgacgctggccgcgatcgcggccggtggtccgttg
ccgtag

DBGET integrated database retrieval system