KEGG   Mycobacterium canettii CIPT 140010059: MCAN_16071Help
Entry
MCAN_16071        CDS       T01585                                 

Gene name
hisD
Definition
putative histidinol dehydrogenase HisD (HDH)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mce01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mce00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1826193..1827509
Genome map
AA seq 438 aa AA seqDB search
MLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAALDFGASFDGV
RPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGATVTERW
VPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGLPHPTILAAARL
LGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLCRSRVGIDAE
AGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAGQLQTTV
HRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSAGAIFVG
PWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSGHVITLA
TAEDLPAHGEAVRRRFER
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgcttacccgtatcgacttgcggggagccgagttgacagctgccgagctgcgggccgct
ctgccacgcggcggcgccgatgtggaagccgtgctgccgacggtacggcccattgtggcg
gccgtcgccgagcgcggggccgaggccgcgctggacttcggcgcatcgttcgacggtgtg
cggccccatgccatccgggtgccagacgcagcgctggacgcggcgctggccggactggac
tgcgacgtctgcgaagcgttgcaggtgatggtcgagcggacccgcgccgtgcactccggg
cagcgtcgcaccgacgtcacaaccacactgggcccgggcgcgacggtcaccgagcggtgg
gttccggtcgagcgggtaggcctgtacgtgccggggggcaatgcggtgtacccatccagc
gtggtgatgaacgtggtgcccgcccaagccgcgggcgtcgactcgttggtggtagccagc
ccgccgcaggcgcagtgggacgggttgccccacccgaccattctggccgcggcccggctg
ctgggcgtcgatgaggtctgggcggtcggcggcgctcaggcggtggcgttgctggcttac
ggcggcaccgacaccgacggcgcagcactgacaccggtcgacatgatcaccgggccgggc
aacatctatgtcacggccgccaagcggctgtgccgttcgcgggtgggcatcgacgccgaa
gcggggccaaccgagatcgctatcctcgccgatcacaccgccgacccggtgcatgtggcc
gccgacctgattagccaggccgaacacgacgagttggctgccagcgtgctggtcactccg
agtgaggaccttgccgatgccaccgacgccgaactggctggccagctgcagactacggtg
caccgcgaacgggtgacggccgcgctgaccggacgccaatcggcgatcgtcctggtcgac
gacgtggacgccgccgtcttggtggtgaacgcttacgccgctgagcatttggagattcag
accgccgatgccccgcaggttgccagccggatccgctcggcgggagccattttcgtcggc
ccgtggtccccggtgagcctcggcgactactgcgcgggatccaaccatgtactgccgacc
gcgggctgcgcccggcattccagcggcctgtcggtgcagacgttcctgcgcggcatccac
gtcgtggaatacacggaggcggccctcaaagacgtttccgggcacgtgatcacgctcgcc
acggccgaggacttgccggcgcacggtgaggcggtacggcggaggttcgagcgatga

DBGET integrated database retrieval system