KEGG   Mycobacterium canettii CIPT 140010059: MCAN_16201Help
Entry
MCAN_16201        CDS       T01585                                 

Gene name
trpB
Definition
putative tryptophan synthase, subunit beta trpB
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCAN_16201 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCAN_16201 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCAN_16201 (trpB)
Enzymes [BR:mce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCAN_16201 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1837885..1839117
Genome map
AA seq 410 aa AA seqDB search
MSAAIAEPTSHDPDSGGHFGGPSGWGGRYVPEALMAVIEEVTAAYQKERVSQDFLDDLDR
LQANYAGRPSPLYEATRLSQHAGSARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRV
IAETGAGQHGVATATACALLGLDCVIYMGGIDTARQALNVARMRLLGAEVVAVQTGSKTL
KDAINEAFRDWVANADNTYYCFGTAAGPHPFPTMVRDFQRIIGMEARVQIQGQAGRLPDA
VVACVGGGSNAIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAGSPGAFHGSFSYL
LQDEDGQTIESHSISAGLDYPGVGPEHAWLKEAGRVDYRPITDSEAMDAFGLLCRMEGII
PAIESAHAVAGALKLGVELGRGAVIVVNLSGRGDKDVETAAKWFGLLGND
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccgccatcgccgaaccgaccagccacgatcctgattccggcggccatttcggc
ggccccagtggttggggtggccgctacgttcccgaggcgctgatggcggtgatcgaagag
gtcaccgccgcctaccaaaaggagcgcgtcagccaggactttctggacgacctggacagg
ctgcaggcgaactatgcgggccggccttcgccgctttacgaggcgacccggttgagccag
cacgctgggtcggcgcgaatctttctgaagcgagaagacctgaaccacactggttctcac
aagatcaacaacgtgctcgggcaggcactgctggcgcgcaggatgggcaagacccgggtg
atcgccgagaccggtgccggccagcacggggtcgccacggccaccgcatgcgcgttgctc
ggcctggactgtgtcatctacatggggggcatcgacaccgcccgtcaggcgctaaacgtg
gcccggatgcgattgctgggtgccgaagtcgtcgcggttcagacgggctcgaaaacgctc
aaagacgccatcaatgaggcgttccgggattgggttgccaacgccgacaacacctactac
tgctttggtacggcggccggaccgcatccgtttccaaccatggtgcgcgatttccagcga
atcatcggcatggaggcacgcgtgcagatccagggtcaggccggtcggctgcctgacgcc
gtcgttgcgtgcgttggtggcgggtccaatgccattggtatttttcatgcgtttcttgat
gacccaggcgtacggctggtcggattcgaggcagccggcgacggcgttgagaccggccgg
catgctgcgacattcaccgctggttcgcccggggcatttcacggatcgttctcgtacttg
ctgcaagacgaggacggtcagaccattgaatcccattcaatctccgcgggtctggattat
ccgggggtgggcccagaacacgcgtggctcaaggaggccgggcgtgtcgattatcggccg
atcaccgactccgaggcgatggacgcgtttggcctactgtgtcgcatggaaggcatcatc
cctgccattgaatccgcgcacgcggtagccggcgccctcaagctaggtgttgagttggga
aggggcgcggtgattgtggtgaacctgtcgggacgtggcgacaaagatgtcgagacggcc
gcgaaatggtttggcttgctgggcaacgactga

DBGET integrated database retrieval system