KEGG   Mycobacterium canettii CIPT 140010059: MCAN_20521Help
Entry
MCAN_20521        CDS       T01585                                 

Gene name
pfkB
Definition
putative phosphofructokinase PfkB
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCAN_20521 (pfkB)
   01230 Biosynthesis of amino acids
    MCAN_20521 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCAN_20521 (pfkB)
   00030 Pentose phosphate pathway
    MCAN_20521 (pfkB)
   00051 Fructose and mannose metabolism
    MCAN_20521 (pfkB)
   00052 Galactose metabolism
    MCAN_20521 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    MCAN_20521 (pfkB)
Enzymes [BR:mce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MCAN_20521 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2325187..2326206)
Genome map
AA seq 339 aa AA seqDB search
MTEPAAWGEGKPRIITLTMNPALDITTSVDVVRPTEKMRCGAPRYDPGGGGINVARIVHV
LGGCSTALFPAGGSTGSLLMALLGDAGVPFRVIPIAASTRESFTVNESRTAKQYRFVLPG
PSLTVAEQEKCLDELRGAAASAAFVVASGSLPPGVAADYYQRVADICRRSSTPLILDTSG
GGLQHISSGVFLLKASVRELRECVGSELLTEPEQLAAAHELIDRGRAEVVVVSLGSQGAL
LATRHASHRFSSIPMTAVSGVGAGDAMVAAITVGLSRGWSLIKSVRLGNAAGAAMLLTPG
TAACNRDDVERFFELAAEPTEVGQGQYVWHPIVNPEAAP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccggcggcgtggggcgaaggcaagccgcgaatcatcactttgaccatgaac
cccgccttggacatcacgacgagcgtcgacgtggtgcgcccgaccgagaaaatgcgttgt
ggcgcacctcgctacgatcccggcggcggcggtatcaatgtcgcccgcattgtgcatgtc
ctcggcggttgctcgacagcactgttcccggccggcgggtcgaccgggagcctgctgatg
gcgctgctcggtgatgcgggagtgccgtttcgggtcattccgatcgcggcctcgacgcgg
gagagcttcacggtcaacgagtccaggaccgccaagcagtatcgtttcgtgcttccgggg
ccgtcgctgaccgtcgcggagcaggagaaatgcctcgacgaactgcgcggtgcggcggct
tcggccgcctttgtggtggccagtggcagcctgccgccaggtgtggctgccgactactat
cagcgggttgccgacatctgccgccgatcgagcactccgctgatcctggatacatctggt
ggcgggttgcagcacatttcgtccggggtgtttcttctcaaggcgagcgtgcgggaactg
cgcgagtgcgtcggatccgaactgctgaccgagcccgaacaattggccgccgcacacgaa
ctcattgaccgtgggcgcgccgaggtcgtggtggtctcgcttggatctcagggtgcgctg
ttggccacacgacatgcgagccatcgattttcgtcgattccgatgaccgcggttagcggt
gtcggcgccggcgacgcgatggtggccgcgattaccgtgggcctcagccgtggctggtcg
ctcatcaagtccgttcgcttgggaaacgcggcaggtgcagccatgctgctgacgccaggc
accgcggcctgcaatcgcgacgatgtggagaggttcttcgagctggcggccgaacccacc
gaagtcgggcagggtcaatacgtttggcacccgatcgttaacccggaagccgcgccatga

DBGET integrated database retrieval system