KEGG   Mycobacterium canettii CIPT 140010059: MCAN_22231Help
Entry
MCAN_22231        CDS       T01585                                 

Gene name
asnB
Definition
putative asparagine synthetase AsnB
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MCAN_22231 (asnB)
Enzymes [BR:mce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MCAN_22231 (asnB)
Peptidases [BR:mce01002]
 Cysteine Peptidases
  Family C44
   MCAN_22231 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2517827..2519785
Genome map
AA seq 652 aa AA seqDB search
MCGLLAFVAAPAGAAGPEGADAASAIARASHLMRHRGPDESGTWHAVDGASGGVVFGFNR
LSIIDIAHSHQPLRWGPPEAPDRYVLVFNGEIYNYLELRDELRTQHGAVFATDGDGEAIL
AGYHHWGTEVLQRLRGMFAFALWDTVTRELFCARDPFGIKPLFIATGAGGTAVASEKKCL
LDLVELVGFDTEIDHRALQHYTVLQYVPEPETLHRGVRRLESGCFARIRADQLAPVITRY
FVPRFAASPITNDNDQARYDEITAVLEDSVAKHMRADVTVGAFLSGGIDSTAIAALAIPH
NPRLITFTTGFEREGFSEIDVAVASAEAIGARHIAKVVSADEFVAALPEIVWYLDEPVAD
PALVPLFFVAREARKHVKVVLSGEGADELFGGYTIYREPLSLRPFDYLPKPLRRSMGKVS
KPLPEGMRGKSLLHRGSLTLEERYYGNARSFSDAQLREVLPGFRPDWTHTDVTAPVYAES
AGWDPVARMQHIDLFTWLRGDILVKADKITMANSLELRVPFLDPEVFAVASRLPAGAKIT
RTTTKYALRRALEPIVPAHVLHRPKLGFPVPIRHWLRAGELLEWAYATVGSSQAGHLVDI
AAVYRMLDEHRCGSSDHSRRLWTMLIFMLWHAIFVEHSVVPQISEPQYPVQL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggactgctggccttcgtcgcggccccggccggtgctgcggggcccgaaggtgcc
gacgctgccagcgccatcgcccgcgcatcgcatttgatgcgccaccgcgggcccgatgaa
tcgggcacctggcacgccgtcgatggcgcctccggaggcgtcgtgttcgggttcaaccga
ctgtccatcatcgacatcgcgcactcgcatcagccgctgcggtgggggccgccggaggct
ccggaccgctacgtgctggtgttcaacggcgagatctacaactacttggagctgcgtgac
gagctgcgcacccagcacggcgctgtgttcgccaccgacggcgacggtgaggcgatcctc
gccggctatcaccactggggcaccgaggtgctgcagcggttgcgcggcatgttcgcattc
gcgctgtgggacaccgtcacccgcgaattgttctgcgcgcgagatccgttcggcatcaag
ccgttgtttatcgccaccggagccggcggcacggcggtggccagtgagaagaaatgcctg
ctggacctcgtcgagttggtggggttcgacaccgagatcgaccatcgggcgttgcagcac
tacaccgtcctgcagtacgtgccggaacccgagacactgcaccgtggggtacgtcggctg
gaatcaggctgcttcgcccggatccgtgccgaccagctcgcgccggtgatcacccgttat
ttcgtgccgcgatttgcggccagtccgatcaccaacgacaacgaccaggcccgctatgac
gagatcacggcagtgcttgaggactcggtggccaagcatatgcgcgccgatgtcaccgtc
ggcgcgtttctgtccgggggtatcgactccacggccatcgcggcgctggccatcccgcac
aatccgcggctgatcaccttcaccaccggtttcgagcgcgagggcttctccgagatcgac
gtcgcggtggcttcggcagaggccatcggtgcccgtcacatcgccaaggtggtcagcgcc
gacgagttcgtcgccgccctgcccgagatcgtctggtacctcgacgagccggtcgctgac
ccagcgctggtaccgttgttcttcgtcgcccgcgaggctcgaaagcacgtcaaagtggtg
ttgtcgggcgaaggcgccgacgaactgttcggcggctacacaatctatcgagaaccgctg
tcgttgaggccgtttgactacctgcccaagccactgcgccggtcgatgggaaaagtttcc
aagccactgccggagggcatgcgcggcaagagtctgctgcaccgcggatcgctgacactc
gaagagcgctactacggcaatgcccgcagtttctccgacgcgcagctgcgcgaagtactg
cccgggttccggccggactggacccacacagatgtgacggcgccggtctacgccgaatcg
gccggctgggatccggtggcgcgaatgcagcacatcgacctgttcacctggctgcgcggc
gacattctggtcaaggccgacaagataacgatggccaactccctggagctgcgggtgccg
ttcctggacccggaggttttcgcggtggcctcccggttgccggcgggcgccaagatcacc
cgtaccaccaccaagtacgcgctgcggcgcgcgctggagcctattgtgcccgcacacgtg
ctgcaccggcccaagctcgggttcccggtcccgatccggcattggctgcgtgccggcgag
ctgctggagtgggcgtatgcgacggtgggctcgtcgcaggccggtcacttggttgacatc
gccgccgtgtatcgcatgctcgacgagcaccggtgcggcagcagcgaccacagccgccgg
ctgtggaccatgctgatctttatgctgtggcacgcgatcttcgtcgagcacagcgtggtg
ccccagatcagcgagccgcagtaccccgtccagttgtaa

DBGET integrated database retrieval system