KEGG   Mycobacterium canettii CIPT 140010059: MCAN_22371Help
Entry
MCAN_22371        CDS       T01585                                 

Gene name
sucB
Definition
(RefSeq) putative pyruvate dehydrogenase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCAN_22371 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCAN_22371 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MCAN_22371 (sucB)
Enzymes [BR:mce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MCAN_22371 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2534795..2536468
Genome map
AA seq 557 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAKDAGEAAAPAPEKVPAAQPESKPAPEPPPVQPTSGAPAGGD
AKPVLMPELGESVTEGTVTRWLKKIGDSVQVDEPLVEVSTDKVDTEIPSPVAGVLVSISA
DEDATVPVGGELARIGVAADIGAAPAPKPAPKPAPKPVPEPAPTPKAEPAPSPPAAQPAG
AAEGAPYVTPLVRKLASENNIDLAEVTGTGVGGRIRKQDVLAAAEQKKRAKAPAPAAQAA
AAPAPKAPPAPAPALAHLRGTTQKASRIRQITANKTRESLQATAQLTQTHEVDMTKIVGL
RARAKAAFAEREGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDAEHLGFAVD
TEQGLLSPVIHDAGDLSLAGLARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFD
TPILVPPQAAMLGTGAIVKRPRVVVDASGNESIGVRSVCYLPLTYDHRLIDGADAGRFLT
TIKHRLEEGAFEADLGL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggttacc
cgctggctcaaacaggaaggcgacacggtcgaactcgacgagcctctcgtggaggtgtcg
accgacaaggtcgacaccgaaatcccctcgccggccgcgggtgtgctgaccaagatcatc
gcccaggaggatgacacggtcgaggtcggcggcgagctcgctgtcattggcgacgccaag
gatgccggcgaggccgcggccccggcacccgagaaagtccctgcggcccaacccgagtcc
aagccggcacccgaaccaccaccggtccaaccgacgtccggagcgcctgctggtggcgat
gccaagccggtgctgatgcccgagctcggcgaatcggtgaccgaggggaccgtcactcgt
tggctgaagaagatcggggattcggttcaggttgacgagccactcgtggaggtgtccacc
gacaaggtggacaccgagatcccgtccccggtggctggggtcttggtcagtatcagcgcc
gacgaggacgccacggtgcccgtcggcggcgagttggcccggatcggtgtcgctgccgac
atcggcgccgcgcccgcccccaagcccgcccccaagcccgcacccaagcccgtccccgag
ccagcgccgacgccgaaggccgaacccgcaccatcgccgccggcggcccagccagccggt
gcggccgagggcgcaccgtacgtgacgccgctggtgcgaaagctggcgtcggaaaacaac
atcgacctcgccgaggtgaccggcaccggagtgggtggtcgcatccgcaaacaggatgtg
ctggccgcggctgagcaaaagaagcgggcgaaagcaccggcgccggccgcccaggccgcc
gccgcgccggccccgaaagcgccgcctgcccctgcgccggcgttggcacatctacggggc
accacccagaaggccagccggattcgtcagatcaccgccaacaagacccgcgaatctttg
caggcaacggcacagctgacacaaacccatgaggtcgacatgaccaagatcgtggggcta
cgggcccgggccaaggcggcgttcgccgagcgtgagggcgtgaacctgaccttcctgccg
ttcttcgccaaggccgtgatcgatgccctcaagattcacccgaacatcaacgccagctac
aacgaggacaccaaggagatcacctactacgacgccgagcacctaggattcgctgtcgac
accgagcagggcctgctctccccggtcatccacgacgccggcgatctgtcactggccggt
ctggcgcgggcgatcgccgatatcgcggcccgtgcccggtcgggcaacctgaaacccgac
gagttgtccggcggcaccttcaccatcaccaacatcggtagccagggcgcgttgttcgac
accccgatcctggttccgccgcaggccgccatgctgggcaccggagcgatcgtcaagcgg
ccgcgggtggtcgtcgatgccagcggcaacgagtcgatcggggtgcgctcggtctgctac
ctcccgttgacctatgaccatcggctcatcgacggcgccgacgccggacgtttcctcacc
acgatcaagcaccgcctcgaagagggagcgttcgaggccgatttaggactgtga

DBGET integrated database retrieval system