KEGG   Mycobacterium canettii CIPT 140010059: MCAN_22431Help
Entry
MCAN_22431        CDS       T01585                                 

Gene name
glnA1
Definition
glutamine synthetase GLNA1
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCAN_22431 (glnA1)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MCAN_22431 (glnA1)
  Energy metabolism
   00910 Nitrogen metabolism
    MCAN_22431 (glnA1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MCAN_22431 (glnA1)
   00330 Arginine and proline metabolism
    MCAN_22431 (glnA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MCAN_22431 (glnA1)
Enzymes [BR:mce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamate---ammonia ligase
     MCAN_22431 (glnA1)
Exosome [BR:mce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCAN_22431 (glnA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2540457..2541893
Genome map
AA seq 478 aa AA seqDB search
MTEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRG
FQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLI
STGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKV
RHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAAD
DMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSD
TARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNP
KAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTP
TQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgacggaaaagacgcccgacgacgtcttcaaacttgccaaggacgagaaggtcgaatat
gtcgacgtccggttctgtgacctgcctggcatcatgcagcacttcacgattccggcttcg
gcctttgacaagagcgtgtttgacgacggcttggcctttgacggctcgtcgattcgcggg
ttccagtcgatccacgaatccgacatgttgcttcttcccgatcccgagacggcgcgcatc
gacccgttccgcgcggccaagacgctgaatatcaacttctttgtgcacgacccgttcacc
ctggagccgtactcccgcgacccgcgcaacatcgcccgcaaggccgagaactacctgatc
agcactggcatcgccgacaccgcatacttcggcgccgaggccgagttctacattttcgat
tcggtgagcttcgactcgcgcgccaacggctccttctacgaggtggacgccatctcgggg
tggtggaacaccggcgcggcgaccgaggccgacggcagtcccaaccggggctacaaggtc
cgccacaagggcgggtatttcccagtggcccccaacgaccaatacgtcgacctgcgcgac
aagatgctgaccaacctgatcaactccggcttcatcctggagaagggccaccacgaggtg
ggcagcggcggacaggccgagatcaactaccagttcaattcgctgctgcacgccgccgac
gacatgcagttgtacaagtacatcatcaagaacaccgcctggcagaacggcaaaacggtc
acgttcatgcccaagccgctgttcggcgacaacgggtccggcatgcactgtcatcagtcg
ctgtggaaggacggggccccgctgatgtacgacgagacgggttatgccggtctgtcggac
acggcccgtcattacatcggcggcctgttacaccacgcgccgtcgctgctggccttcacc
aacccgacggtgaactcctacaagcggctggttcccggttacgaggccccgatcaacctg
gtctatagccagcgcaaccggtcggcatgcgtgcgcatcccgatcaccggcagcaacccg
aaggccaagcggctggagttccgaagccccgactcgtcgggcaacccgtatctggcgttc
tcggccatgctgatggcaggcctggacggtatcaagaacaagatcgagccgcaggcgccc
gtcgacaaggatctctacgagctgccgccggaagaggccgcgagtatcccgcagactccg
acccagctgtcagatgtgatcgaccgtctcgaggccgaccacgaatacctcaccgaagga
ggggtgttcacaaacgacctgatcgagacgtggatcagtttcaagcgcgaaaacgagatc
gagccggtcaacatccggccgcatccctacgaattcgcgctgtactacgacgtttaa

DBGET integrated database retrieval system