KEGG   Mycobacterium canettii CIPT 140010059: MCAN_26351Help
Entry
MCAN_26351        CDS       T01585                                 

Gene name
ruvA
Definition
putative Holliday junction DNA helicase RUVA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCAN_26351 (ruvA)
Enzymes [BR:mce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MCAN_26351 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2993925..2994515)
Genome map
AA seq 196 aa AA seqDB search
MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLY
GFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGA
ERMVLELRDKVGVAATGGALSTNGHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDAT
TSSALRSALSLLGKAR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcggtccgcggtgaggtgctcgaggtggcgcttgaccatgtggtgatcgag
gccgccggtgtgggctaccgagtgaacgcgacaccggcgacgctggcgacgttgcggcaa
ggcaccgaggcccggctgatcaccgcgatgattgtgcgcgaggactcgatgacgctgtac
gggtttcccgacggggaaacccgcgacctattcctgacgctgctgtcggtctccggcgtt
gggccccggctggcgatggcggcactggccgtgcacgacgctccggcgctacggcaggtg
ctggccgacggcaacgtcgccgccctgacccgggtgcctgggatcggcaagcggggcgcc
gaacgcatggtgttggaactacgcgacaaggttggggtggcagccaccggcggcgcactc
tcgaccaacggccacgcggtgcgcagtcccgtggtcgaggctctggtcggcctgggcttt
gcggccaaacaggccgaggaggccaccgatacggtgctggccgccaaccatgacgcgacg
acatccagcgcgctgcggtctgccttgtcgttgctggggaaggcccgatga

DBGET integrated database retrieval system