KEGG   Mycobacterium canettii CIPT 140010059: MCAN_27281Help
Entry
MCAN_27281        CDS       T01585                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase PPGK (polyphosphate-glucose phosphotransferase)
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00010  Glycolysis / Gluconeogenesis
mce00520  Amino sugar and nucleotide sugar metabolism
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01120  Microbial metabolism in diverse environments
mce01130  Biosynthesis of antibiotics
mce01200  Carbon metabolism
Module
mce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCAN_27281 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    MCAN_27281 (ppgK)
Enzymes [BR:mce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     MCAN_27281 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: CCC45059
UniProt: G0TQT3
Position
3076089..3076886
Genome map
AA seq 265 aa AA seqDB search
MTSTGPETSETPGATTQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAV
AKTIAEVVNGFGWRGPLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELDGQQVTI
LNDADAAGLAETRYGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAE
ERAASSVKEKNDWTYPKWAKQVTRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTP
VVPAALQNTAGIVGAAMASVADTTH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccggccccgagacgtccgaaacaccgggtgccacgacacagcgtcatggc
ttcggcatcgacgtcggcggcagcggcatcaagggcggaatcgtcgacttggacaccggc
cagctgatcggcgaccggatcaagctgctgaccccgcaaccggccactccgttggcggtc
gccaaaaccatcgccgaggtcgtcaacggtttcggctggcggggtccgctgggggtgacc
tatcccggcgtcgtcactcacggcgtcgtccggaccgcggctaacgtggacaagtcctgg
atagggaccaacgcacgcgacactatcggcgccgagctggacggtcagcaggtcaccatc
ctcaacgacgctgatgccgccgggctggccgagacacgctacggggccggcaagaacaac
cctggcttagtggtactgctcacattcggaaccgggatcgggtccgcggtcatccacaac
gggacgttgatacccaacaccgagttcggacatcttgaggtcggcggcaaggaagcggag
gaaagggccgcctcctcggtaaaggaaaagaacgactggacctatccaaagtgggccaag
caggtgacacgcgtgctcatcgccatcgagaacgcgatctggcctgacctgttcatcgcc
ggcggcggcatcagccgcaaggccgacaaatgggtgccgctactggaaaaccgcacccca
gtagtgcccgcggccctgcagaacaccgccggaattgtcggtgcggccatggcctctgtc
gcagatacgacgcactga

DBGET integrated database retrieval system