KEGG   Mycobacterium canettii CIPT 140010059: MCAN_27671Help
Entry
MCAN_27671        CDS       T01585                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCAN_27671
Enzymes [BR:mce01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     MCAN_27671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3112463..3112912
Genome map
AA seq 149 aa AA seqDB search
MAELTETSPETPETTEAIRAVEAFLNALQSEDFDTVDAALGDDLVYENVGFSRIRGGRRT
ATLLRRMQGRVGFEVKIHRIGADGAAVLTERTDALIIGPLRVQFWVCGVFEVDDGRITLW
RDYFDVYDMFKGLLRGLVALVVPSLKATL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgaccgaaacatcgccggaaacccccgaaaccaccgaggccattcgtgcc
gtcgaggcgttcctcaacgccctgcagagcgaagacttcgacaccgtcgacgccgcactg
ggcgacgacctggtctatgagaacgtcgggttttccaggatccgcggtggccgccgcacg
gcaacgctgcttcgccgcatgcagggccgcgtcggcttcgaggtgaagatccaccgcatc
ggcgccgacggcgccgcggtgctcaccgaacgcaccgacgcgctaatcatcggaccgctg
cgggtgcagttctgggtctgcggcgtattcgaggtggacgatgggcggatcaccctgtgg
cgggactacttcgatgtctacgacatgttcaagggcctcttgcgaggcctggtggcgctg
gtggtgccatcgctgaaggcaacgctgtag

DBGET integrated database retrieval system