KEGG   Mycobacterium canettii CIPT 140010059: MCAN_28921Help
Entry
MCAN_28921        CDS       T01585                                 

Gene name
dxr
Definition
(GenBank) putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase DXR (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase)
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00900  Terpenoid backbone biosynthesis
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01130  Biosynthesis of antibiotics
Module
mce_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCAN_28921 (dxr)
Enzymes [BR:mce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MCAN_28921 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Sacchrp_dh_NADP Semialdhyde_dh CoA_binding_3
Motif
Other DBs
NCBI-ProteinID: CCC45223
UniProt: G0TFG9
Position
complement(3240405..3241646)
Genome map
AA seq 413 aa AA seqDB search
MTNSTDGRADGRLRVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTLLRQRAQ
TGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNALVGALGLRPTLAALKTG
ARLALANKESLVAGGSLVLRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGP
FRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVV
VHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLALGWPRRVSGAAAACDFHTASSWEFEP
LDTDVFPAVELARQAGVAGGCMTAVYNAANEEAAAAFLAGRIGFPAIVGIIADVLHAADQ
WAVEPATVDDVLDAQRWARERAQRAVSGMASVAIASTAKPGAAGRHASTLERS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaactcgaccgacgggcgcgctgacggccggttgcgggtggtggtgctgggcagt
accggctcgatcggcacccaggcgcttcaggtcatcgccgacaatccggaccgtttcgag
gtagtcgggctggccgctggcggcgcccatctggacacgttgctgcgacaacgtgcgcag
accggggtgaccaatattgccgtcgctgacgagcacgcggcgcagcgggtcggcgacatc
ccctaccacggatccgacgccgccacccggctggtcgagcagaccgaggccgacgtcgtc
ctcaatgcgctggtcggcgcgttgggcctgcgaccgacgttggccgcgctcaagacgggt
gcccggctggcgctggccaacaaggaatcgttggtcgccggtggttcgctggtgctgcgg
gcggcgcggcccggtcagatcgtgccggtcgactccgaacactccgcgctggcccagtgc
ctgcgcggcggcactcccgacgaggtcgccaagctggtgctgacggcctcgggagggccg
tttcggggctggtccgcggccgacctcgagcatgtcacccccgagcaggccggcgcgcat
cctacgtggtcgatgggcccgatgaacacgctgaattcggcgtcgctggtcaacaaggga
cttgaggtcatcgaaacccacctgctgttcggcatcccctacgaccgcatcgatgtcgtg
gtgcacccccagtcgatcatccattcgatggtcaccttcatcgacggttcgacgatcgcc
caggccagtcccccggacatgaagctaccgatttcgttagcgctgggctggccgcgtcgg
gtcagcggcgccgctgctgcctgtgatttccataccgcgtcgagctgggagttcgagccg
ttggacaccgacgtcttccccgcggtcgagttggcccggcaggccggcgtagccggtggc
tgcatgaccgcggtttacaatgcggcgaacgaagaagcagcagcggcgttccttgctggc
cggatcggcttcccggccatcgtcggcatcatcgccgacgtgttgcacgctgccgaccaa
tgggccgtcgaacccgctaccgtggatgacgtactcgacgcgcagcgctgggcccgcgag
cgagcgcagcgcgcggtatctggtatggcttcggtggcgatcgcaagcacggcgaagccg
ggcgcagcgggtcgacacgcatcgacgttagaaaggtcctga

DBGET integrated database retrieval system