KEGG   Mycobacterium canettii CIPT 140010059: MCAN_30641Help
Entry
MCAN_30641        CDS       T01585                                 

Gene name
echA17
Definition
putative enoyl-CoA hydratase ECHA17
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MCAN_30641 (echA17)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MCAN_30641 (echA17)
   00650 Butanoate metabolism
    MCAN_30641 (echA17)
  Lipid metabolism
   00071 Fatty acid degradation
    MCAN_30641 (echA17)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCAN_30641 (echA17)
   00310 Lysine degradation
    MCAN_30641 (echA17)
   00360 Phenylalanine metabolism
    MCAN_30641 (echA17)
   00380 Tryptophan metabolism
    MCAN_30641 (echA17)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCAN_30641 (echA17)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCAN_30641 (echA17)
   00281 Geraniol degradation
    MCAN_30641 (echA17)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCAN_30641 (echA17)
   00627 Aminobenzoate degradation
    MCAN_30641 (echA17)
   00930 Caprolactam degradation
    MCAN_30641 (echA17)
Enzymes [BR:mce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCAN_30641 (echA17)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3460772..3461536)
Genome map
AA seq 254 aa AA seqDB search
MPEFVNVVVSDGSQDAGLAMLLLSRPPTNAMTRQVYREVVAAANELGRRDDVAAVILYGG
HEIFSAGDDMPELRTLSAQEADTAARIRQQAVDAVAAIPKPTVAAITGYALGAGLTLALA
ADWRVSGDNVKFGATEILAGLIPSGDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGL
IDDMVAPDDVYDAAAAWARRFLDGPPHALAAAKAGISDVYELAPAERIAAERRRYVEVFA
AGQGGGSKGDRGGR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagttcgtcaacgtcgtggtcagtgacggctcccaggatgccggcctggccatg
ttgctcctatcgcgaccgcctaccaacgcgatgacccgccaggtctaccgggaagtggtc
gccgcggccaacgagctggggcgacgcgacgacgtggccgcagtgatcctgtatggcggc
cacgaaatcttctccgccggcgacgacatgcccgaactgcggacattgagcgcgcaggag
gccgacaccgccgcccggattcggcagcaggccgtcgacgccgttgcggcgatccccaag
ccgaccgtggccgccatcaccggatacgcgttgggtgccggccttacgctggccctagcc
gccgattggcgagtcagcggtgacaacgtgaaattcggcgcgaccgagatcctggccggc
ctgatccccagcggcgacggaatggcccggctgacccgtgcggccggtccgagcagagcc
aaggagctggtgttcagcgggcgcttcttcgacgccgaggaggccttggcgctgggcctg
atcgacgacatggtggccccagacgacgtttacgacgccgcggcggcctgggcgaggcgc
tttcttgacggcccgccgcacgcgctggccgcggccaaagccgggatcagcgacgtctac
gagctggcgccggccgagcggatcgccgctgagcgtcggcgctatgtcgaggttttcgcc
gctggtcaaggtggtggcagcaagggtgaccggggcggccgttag

DBGET integrated database retrieval system