KEGG   Mycobacterium canettii CIPT 140010059: MCAN_33431Help
Entry
MCAN_33431        CDS       T01585                                 

Gene name
sdhD
Definition
(GenBank) putative succinate dehydrogenase (hydrophobic membrane anchor subunit) SDHD (succinic dehydrogenase) (fumarate reductase) (fumarate dehydrogenase) (fumaric hydrogenase)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00020  Citrate cycle (TCA cycle)
mce00190  Oxidative phosphorylation
mce00650  Butanoate metabolism
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01120  Microbial metabolism in diverse environments
mce01130  Biosynthesis of antibiotics
mce01200  Carbon metabolism
Module
mce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mce_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCAN_33431 (sdhD)
   00650 Butanoate metabolism
    MCAN_33431 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MCAN_33431 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: CCC45674
UniProt: G0TI55
Position
3768485..3768919
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKGTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaaggcaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system