KEGG   Mycobacterium canettii CIPT 140010059: MCAN_34531Help
Entry
MCAN_34531        CDS       T01585                                 

Gene name
glmS
Definition
putative glucosamine--fructose-6-phosphate aminotransferase [isomerizing] GLMS
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mce00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mce00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3914215..3916089)
Genome map
AA seq 624 aa AA seqDB search
MCGIVGYVGRRPAYVVVMDALRRMEYRGYDSSGIALVDGGTLTVRRRAGRLANLEEAVAE
MPSTALSGTTGLGHTRWATHGRPTDRNAHPHRDAAGKIAVVHNGIIENFAVLRRELETAG
VEFASDTDTEVAAHLVARAYRHGETADDFVGSVLAVLRRLEGHFTLVFANADDPGTLVAA
RRSTPLVLGIGDNEMFVGSDVAAFIEHTREAVELGQDQAVVITAGGYRISDFDGNDGLQA
GRDFRPFHIDWDLAAAEKGGYEYFMLKEIAEQPTAVADTLLGHFVGGRIVLDEQRLSDQE
LREIDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELASEFRYRDPVLDRSTLVVAISQ
SGETADTLEAVRHAKEQKAKVLAICNTNGSQIPRECDAVLYTRAGPEIGVASTKTFLAQI
AANYLLGLALAQARGTKYPDEVEREYHELEAMPDLVARVIATTEPVASLAYRFAQSSTVL
FLGRHVGYPVALEGALKLKELAYMHAEGFAAGELKHGPIALIEDNLPVIVVMPSPKGSAT
LHAKLLSNIREIQSRGAVTIVIAEEGDDTVRPYADHLIEIPAVSTLLQPLLSTIPLQVFA
ASVARARGYDVDKPRNLAKSVTVE
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggaattgtcggttacgtcgggcggcgccccgcctacgtcgtcgtcatggacgcg
ctgcgccggatggagtaccgcggctacgactcgtcgggcatcgcgctggtcgacggtggc
acactcaccgtgcgccggcgtgcgggccggctggccaacctcgaggaagccgtggcggaa
atgccgtccacggcgctgtccggtactaccggcctgggccacacccgctgggccacccac
ggtcgtcccaccgaccgcaacgcgcacccgcaccgcgacgctgccggcaagatcgccgtc
gtccacaacggcatcatcgagaacttcgccgtcttgcgccgggagctggagactgccggt
gtcgagtttgccagcgacaccgataccgaggtcgcggcgcacctggtggcgcgggcgtat
cggcacggcgagacggccgatgacttcgtcggctccgtacttgccgtgctgcgccggctt
gaggggcatttcacgctcgtattcgccaatgccgacgaccccggcaccctcgtggcggcc
cgccgttccacgcccctggtgctgggcatcggcgacaacgagatgttcgtcggttccgac
gtggccgcgtttatcgagcacacccgggaagcggtcgagctcggccaggaccaggcggtg
gtgatcaccgccggcggctaccggatcagcgatttcgacggcaacgatggcctacaagct
gggcgcgatttccgccccttccacatcgactgggatctggccgccgccgaaaagggcggc
tacgagtacttcatgctcaaagagatcgccgaacagcccaccgcggtggccgacaccctg
ctcggacacttcgtgggtggccggatcgtgctcgacgagcagcgattgagcgaccaggaa
ctgcgcgagatcgacaaggtgttcgtggtggcctgcggtaccgcatatcactccgggctg
ctggccaagtacgcgatcgagcactggacccggctgcctgtggaagtggaactcgccagc
gagtttcggtatcgggatccggtgttggaccgtagcaccttggtggtggcgatctcgcag
tccggggaaaccgccgacacgctggaagcggtccgacacgccaaggagcagaaagccaag
gtgctggcgatctgcaacaccaacggctcgcagatcccgcgcgagtgcgacgcggtgctc
tacacccgcgccggcccggagatcggtgtggcgtctacaaaaacgtttctggcgcagatt
gctgccaactatctgctcggccttgccttggcgcaggcccgcggcaccaaataccccgac
gaggtcgagcgcgagtaccacgaactggaagcgatgccggacctggtggcccgggtgatt
gcgacgacggaaccggtggccagcctggcctaccggttcgcccagtcgtcgaccgtgctg
ttcctgggtcgccatgtcggctatccggtggcgcttgagggtgcactcaaactcaaggag
ttggcctacatgcacgccgagggtttcgcggccggcgagctcaagcacggcccgatcgcg
ctgatcgaggacaacctgccggtgatcgtggtcatgccctcgcccaaggggtcggccacg
ttgcacgcaaagctgctgtccaacatccgagagatccagagccgcggtgcggtgaccatc
gtgatcgccgaggagggcgatgataccgtgcgtccctacgccgatcacttgatcgaaatc
ccagcggtgtcaacgcttctgcagccgctgctatcaaccattccgcttcaggtgttcgcg
gcttcggtggcgcgcgcccgcggctacgacgtcgacaagccgcgaaatttggccaagtcc
gtcaccgtcgaatag

DBGET integrated database retrieval system