KEGG   Mycobacterium canettii CIPT 140010059: MCAN_35571Help
Entry
MCAN_35571        CDS       T01585                                 

Gene name
fadA5
Definition
(GenBank) putative acetyl-CoA acetyltransferase FADA5 (acetoacetyl-CoA thiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCAN_35571 (fadA5)
   00630 Glyoxylate and dicarboxylate metabolism
    MCAN_35571 (fadA5)
   00640 Propanoate metabolism
    MCAN_35571 (fadA5)
   00650 Butanoate metabolism
    MCAN_35571 (fadA5)
  Lipid metabolism
   00071 Fatty acid degradation
    MCAN_35571 (fadA5)
   00072 Synthesis and degradation of ketone bodies
    MCAN_35571 (fadA5)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCAN_35571 (fadA5)
   00310 Lysine degradation
    MCAN_35571 (fadA5)
   00380 Tryptophan metabolism
    MCAN_35571 (fadA5)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCAN_35571 (fadA5)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCAN_35571 (fadA5)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MCAN_35571 (fadA5)
Enzymes [BR:mce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MCAN_35571 (fadA5)
Exosome [BR:mce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCAN_35571 (fadA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4037740..4038915
Genome map
AA seq 391 aa AA seqDB search
MGYPVIVEATRSPIGKRNGWLSGLHATELLGAVQKAVVDKAGIQSGLHAGDVEQVIGGCV
TQFGEQSNNISRVAWLTAGLPEHVGATTVDCQCGSGQQANHLIAGLIAAGAIDVGIACGI
EAMSRVGLGANAGPDRSLIRAQSWDIDLPNQFEAAERIAKRRGITREDVDVFGLESQRRA
QRAWAEGRFDREISPIQAPVLDEQNQPTGERRLVFRDQGLRETTMAGLGELKPVLEGGIH
TAGTSSQISDGAAAVLWMDEAVARAHGLTPRARIVAQALVGAEPYYHLDGPVQSTAKVLE
KAGMKIGDIDIVEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGCTGSRLITTA
LHELERTDQSLALITMCAGGALSTGTIIERI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggttacccggtcatcgttgaagccacccgcagccccatcggcaaacgcaacggatgg
ctgtcggggctgcatgccaccgagttgttgggcgcggtgcaaaaggcggtggtcgacaag
gccggcatccagtccggccttcacgccggtgacgtcgaacaggtcatcggcggttgcgtg
acccagttcggggagcaatccaacaacatcagccgggtggcctggctgacggccggtttg
cccgaacacgtcggcgccaccaccgtcgactgccagtgcggcagcggccagcaggccaac
catctgattgccgggttgatcgcggccggtgccatcgatgtcggcatcgcctgcggcatc
gaggcgatgagccgggtcgggctgggcgccaacgccgggccggaccgctcgctgatccgc
gcgcagtcatgggatatcgacctgccgaaccagttcgaggccgccgagcggatcgccaag
cggcgcggcatcacccgcgaggacgtggatgtcttcgggctcgagtcgcagcgacgcgcg
cagcgggcctgggcggagggccgctttgaccgcgagatctcgccgatccaggcgccggtg
ctcgacgagcagaatcagcccaccggcgagcggcgcctggtctttcgcgaccagggcctg
cgcgagaccacgatggcggggctaggcgagctgaaaccggtgctcgagggcggcatccac
accgcgggcacgtcgtcgcagatctccgacggcgcggcagccgtgttgtggatggacgaa
gccgtggcacgtgcgcacggcctgaccccgcgggcccggatcgtcgcccaggcactcgtc
ggcgccgagccctactaccacctggacggcccggtgcagtccaccgcgaaggtgctggag
aaggccggcatgaagatcggcgacatcgacatcgtcgagatcaacgaggcgttcgcgtcc
gtggtgctgtcctgggcgcgggtgcacgagcccgacatggaccgggtcaacgtcaacggc
ggggcgatcgcgctggggcatccggtgggctgcaccggcagccggctgatcaccaccgcc
ctgcacgagctcgagcgcaccgaccagagcctcgcgctgatcaccatgtgcgccggcggg
gccctgtccaccggcaccatcatcgagcggatttaa

DBGET integrated database retrieval system