KEGG   Mycobacterium canettii CIPT 140010059: MCAN_35611Help
Entry
MCAN_35611        CDS       T01585                                 

Gene name
echA20
Definition
(GenBank) putative enoyl-CoA hydratase ECHA20 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00071  Fatty acid degradation
mce00280  Valine, leucine and isoleucine degradation
mce00281  Geraniol degradation
mce00310  Lysine degradation
mce00360  Phenylalanine metabolism
mce00362  Benzoate degradation
mce00380  Tryptophan metabolism
mce00410  beta-Alanine metabolism
mce00627  Aminobenzoate degradation
mce00640  Propanoate metabolism
mce00650  Butanoate metabolism
mce00903  Limonene and pinene degradation
mce00930  Caprolactam degradation
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01120  Microbial metabolism in diverse environments
mce01130  Biosynthesis of antibiotics
mce01212  Fatty acid metabolism
Module
mce_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MCAN_35611 (echA20)
   00650 Butanoate metabolism
    MCAN_35611 (echA20)
  Lipid metabolism
   00071 Fatty acid degradation
    MCAN_35611 (echA20)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCAN_35611 (echA20)
   00310 Lysine degradation
    MCAN_35611 (echA20)
   00360 Phenylalanine metabolism
    MCAN_35611 (echA20)
   00380 Tryptophan metabolism
    MCAN_35611 (echA20)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCAN_35611 (echA20)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCAN_35611 (echA20)
   00281 Geraniol degradation
    MCAN_35611 (echA20)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCAN_35611 (echA20)
   00627 Aminobenzoate degradation
    MCAN_35611 (echA20)
   00930 Caprolactam degradation
    MCAN_35611 (echA20)
Enzymes [BR:mce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCAN_35611 (echA20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCC45892
UniProt: G0TJI2
Position
4041336..4042079
Genome map
AA seq 247 aa AA seqDB search
MPITSTTPEPGIVAVTVDYPPVNAIPSKAWFDLADAVTAAGANPDTRAVILRAEGRGFNA
GVDIKEMQRTEGFTALIDANRGCFAAFRAVYECAVPVIAAVNGFCVGGGIGLVGNSDVIV
ASEDATFGLPEVERGALGAATHLSRLVPQHLMRRLFFTAATVDAATLQHFGSVHEVVSRD
QLDEAALRVARDIAAKDTRVIRAAKEALNFIDVQRVNASYRMEQGFTFELNLAGVADEHR
DAFVKKS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcacctccaccacgcccgaaccgggcatcgtcgcggtcaccgtcgactacccg
ccggtcaacgccatcccgtcgaaagcgtggttcgacctggccgacgcggtgacggccgcg
ggcgccaaccccgacacccgcgcggtgatcctgcgggccgaggggcgcggcttcaacgcc
ggggtggacatcaaagagatgcaacgaaccgaaggtttcacggcgctgatcgacgccaac
cgcggctgcttcgccgcattccgcgccgtctacgagtgcgcggtgccggtgatcgccgcc
gtgaacggattctgcgtgggcggcggcatcggcctggtcggcaactccgacgtcatcgtg
gcctccgaggacgccaccttcggcctgcccgaggtggaacggggcgcgctgggcgcggcc
acccacctctcgcggctggtgccccagcacctgatgcgacggctgttctttacggcggcc
accgtggacgcggccaccttgcagcacttcggctcggtgcacgaggtggtgtcccgcgat
cagctggacgaggccgctttgcgggtggcccgcgacatcgccgccaaagacacccgggtc
atccgcgcagccaaggaggcgctgaacttcatcgacgtgcaacgggtcaatgcgagttac
cggatggagcaaggttttaccttcgagctcaacctcgccggagtcgccgacgagcaccgc
gacgcctttgtgaagaagtcatag

DBGET integrated database retrieval system