KEGG   Mycobacterium canettii CIPT 140010059: MCAN_36211Help
Entry
MCAN_36211        CDS       T01585                                 

Gene name
folE
Definition
GTP cyclohydrolase I FOLE
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mce00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4102794..4103402)
Genome map
AA seq 202 aa AA seqDB search
MSQLDSRSASARIRVFDQQRAEAAVRELLYAIGEDPDRDGLVATPSRVARSYREMFAGLY
TDPDSVLNTMFDEDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDDGRVTGLSKIA
RLVDLYAKRPQVQERLTSQIADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSA
VRGLFKTNAASRAEALDLILRK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagctggattcgcgcagcgcatctgctcgtatccgtgtgttcgaccagcaacgt
gccgaggccgcggtgcgcgaattgctgtacgcgatcggcgaggatccggatagggacggc
ttggtagccaccccgtcccgggttgcccggtcataccgcgaaatgttcgccgggctctac
accgaccccgactcggtgttgaacaccatgttcgacgaagaccacgacgagctggtgttg
gtcaaggaaatccctatgtactccacctgcgaacaccacctggtggcgttccacggtgtg
gcccacgtcggctacatcccgggcgacgacggcagggtgaccggcttgtcaaagatcgcg
cgactggtcgatctgtacgccaagcgacctcaggtccaggagcggctcaccagtcagatc
gccgatgccctgatgaaaaaactcgatccacgcggggtaatcgtggtgatcgaggctgag
catctgtgcatggcgatgcgcggggttcgcaagcccggctcggtcaccactacgtcggcg
gtgcgcggactgttcaaaaccaatgccgcttctcgagccgaagcgctcgacctcattttg
cggaagtga

DBGET integrated database retrieval system