KEGG   Mycobacterium canettii CIPT 140010059: MCAN_37941Help
Entry
MCAN_37941        CDS       T01585                                 

Gene name
echA21
Definition
putative enoyl-CoA hydratase ECHA21
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MCAN_37941 (echA21)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MCAN_37941 (echA21)
   00650 Butanoate metabolism
    MCAN_37941 (echA21)
  Lipid metabolism
   00071 Fatty acid degradation
    MCAN_37941 (echA21)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCAN_37941 (echA21)
   00310 Lysine degradation
    MCAN_37941 (echA21)
   00360 Phenylalanine metabolism
    MCAN_37941 (echA21)
   00380 Tryptophan metabolism
    MCAN_37941 (echA21)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCAN_37941 (echA21)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCAN_37941 (echA21)
   00281 Geraniol degradation
    MCAN_37941 (echA21)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCAN_37941 (echA21)
   00627 Aminobenzoate degradation
    MCAN_37941 (echA21)
   00930 Caprolactam degradation
    MCAN_37941 (echA21)
Enzymes [BR:mce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCAN_37941 (echA21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4287398..4288222
Genome map
AA seq 274 aa AA seqDB search
MGETYESVTVETKDQVAQVTLIGPGKGNAMGPAFWSEMPEVFHALDADREVRAIVITGSG
KNFSYGLDVPAMGGMFAPLIADGALARPRTDFHTEILRMQKAINAVADCRTPTIAAVQGW
CIGGAVDLISAVDIRYASADAKFSVREVKLAIVADMGSLARLPLILSDGHLRELALTGKN
IDAARAEKIGLVNDVYDDADQTLAAAHATAAEIAANPPLAVYGIKDVLDQQRTSAVSENL
RYVAAWNAAFLPSKDLTEGISATFAKRPPQFTGE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaacctacgaatccgtcaccgtcgaaaccaaggaccaggtcgcgcaggtgacg
ctgatcggaccgggcaagggcaacgcgatggggcccgcattctggtcggagatgcccgag
gtgttccatgccctggacgccgaccgtgaggtgcgggccatcgtcatcaccggatcgggc
aagaacttcagctacggcctggacgtaccggccatgggcggaatgttcgccccgttgatc
gccgacggcgcgctggcccgcccacgcacggacttccacaccgaaatactgcgcatgcag
aaggcgatcaacgccgtcgccgactgccgcacccccacgatcgcggccgtccagggttgg
tgcatcggcggcgccgtcgacctgatctccgcggtcgacatccggtatgccagcgccgac
gcgaagttctcggtgcgcgaggtcaagctagcgattgttgccgacatgggcagcctggcg
cgccttccactaatcctgagcgacggccatctacgagaactcgcgctgaccggcaaaaac
atcgacgcggcccgcgccgagaagatcggcctggtcaacgacgtctacgatgacgccgac
cagacgctggccgcggcccacgcgactgccgccgagatcgccgccaacccacctttggcg
gtctacggcatcaaggacgttctcgaccaacaacgcacgtccgccgtctcggagaacctg
cgctatgtcgccgcctggaacgccgcgtttctgccgtccaaggacctcaccgaaggtatt
tccgcgacgttcgccaagcgcccgccccagttcaccggcgagtag

DBGET integrated database retrieval system