KEGG   Macaca fascicularis (crab-eating macaque): 101864785Help
Entry
101864785         CDS       T02918                                 

Definition
uncharacterized LOC101864785
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101864785
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     101864785
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101864785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 417 aa AA seqDB search
MAGPFSRLLSARPGIRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHN
NCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAD
LFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACT
RAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGM
ARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEQLIQER
GWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDT
AATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcccttctcccgtctgctgtccgcccgcccgggaatcaggctcctggctttg
gccggagcggggtctctagccgctgggtttctgctgcgaccggaacctgtacgagcggcc
agtgaacgacggaggctgtatcccccgagcgctgagtacccagacctccgaaagcacaac
aactgcatggccagtcacctgaccccagcagtctatgcacggctctgcgacaagaccaca
cccactggttggacattagatcagtgtatccagactggcgtggacaaccctggccacccc
ttcatcaagactgtgggcatggtggctggagatgaggagacctatgaggtatttgctgac
ctgtttgaccctgtgatccaagagcgacacaatggatatgacccccggacaatgaagcac
accacggatctggatgccagtaaaatccgttctggctactttgatgagaggtatgtattg
tcctctagagtcagaactggccgaagcatccgaggactcagtctgcctccagcttgcact
cgagcagagcgacgggaggtggaacgtgttgtggtggatgcactgagtggcctgaagggt
gacctggctggacgttactataggctcagtgagatgacagaggctgaacagcagcagctg
attgatgaccactttctgtttgataagcctgtgtccccattgctgactgcagcaggaatg
gctcgagactggccagatgctcgtggaatttggcacaacaatgagaagagcttcctgatc
tgggtgaatgaggaggatcatacacgggtcatctccatggagaagggtggcaacatgaag
agagtgtttgaaagattctgccgaggcctcaaagaggtggagcaacttatccaagaacgt
ggctgggagttcatgtggaatgagcgtttgggatacatcttgacctgtccatctaacctg
ggcactggacttcgggcaggagtgcacatcaaactgcccctgctaagcaaagatagccgc
ttcccaaagatcctggagaacctaaggctccaaaagcgtggtactggaggagtggacact
gctgccacaggcggtgtctttgatatttctaatttggaccgactaggcaaatcagaggtg
gagcttgtgcagctggtcatcgatggagtaaactatttgattgattgtgaacggcgtctg
gagagaggccaggatatccgcatccccacacctgtcatccacaccaagcattaa

DBGET integrated database retrieval system