KEGG   Macaca fascicularis (crab-eating macaque): 101865907Help
Entry
101865907         CDS       T02918                                 

Definition
uncharacterized LOC101865907
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101865907
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101865907
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101865907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 702 aa AA seqDB search
MAAPVTPAARAEDSEAALNAALADVPELARLLEVDPYLKPYAVDFQRRYKQFSQILNNIG
ENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYG
KWKLYIPPKQNKSALVPHGSKLKVVITSKSGEILYRISPWAKYVVREGANVNYDWLHWDP
EHSYEFKHSRPKKPRSLRIYECHVGISSHEGKVASYKHFTCNVLPRIKDLGYNCIQLMAI
MEHAYYASFGYQITSFFAASSRYGTPEELKELVDTAHSMGIIVLLDVVHSHASKNSADGL
NMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVT
SMLYHHHGMGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLYPDSITIAEDVSGMPAL
CSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESH
DQALVGDKTVAFWLMDAEMYTNMSVLSPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMG
NEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERCGWLSAP
QAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGH
QRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccggtgactcccgcggctcgggccgaggactccgaggcggcgctcaatgcc
gccctggctgacgtgcccgaactggccagactcctggaggtcgacccgtacttgaagccc
tacgccgtggacttccagcgcaggtataaacagtttagccaaattttgaacaacattgga
gaaaacgaaggtggtattgataagttttccagaggctatgaatcatttggcgtccacaga
tgtgctgatggtggtttatactgcaaagaatgggccccgggagcagaaggagtttttctt
actggagattttaatggttggaatccattttcatacccatataaaaaactggattatgga
aaatggaagctgtatattccaccaaagcagaataaatctgcgctcgtgcctcatggatcc
aagttaaaggtagttattactagtaaaagcggagagatcttgtatcgtatttcaccgtgg
gcgaagtatgtggttcgtgaaggtgctaatgtgaactatgattggctacactgggatcca
gaacactcatatgaatttaagcattccagaccaaagaagccacgaagtctaagaatttat
gaatgtcatgtgggaatttcttcccatgaaggaaaagtagcttcttataaacattttacg
tgcaatgtactaccaagaatcaaagaccttggatacaactgcattcagttgatggcaatc
atggagcatgcttactatgccagctttggttaccaaatcacgagcttctttgcagcttca
agccgttatggaacacctgaagagctaaaagaactggtagacacagctcattccatgggt
atcatagtcctcttagatgtggtacacagccatgcttcaaaaaattcagcagatggattg
aatatgtttgatgggacagattcctgttattttcattctggacctagagggactcatgat
ctttgggatagcagattgtttgcctactccagctgggaagttttaagattccttctgtca
aacataagatggtggttggaagaatatcgctttgatggatttcgttttgatggtgttaca
tccatgctttatcatcaccatggaatgggtcaaggtttctcaggtgattacagtgaatat
ttcggactacaagtagatgaagatgccttgacttacctcatgttggcaaatcatttggtt
cacacgctgtatccagattctataacaatagctgaggatgtatcaggaatgccggctctg
tgctctccaatttcccagggagggggtggtttcgactatcgactagccatggcaattcct
gataagtggattcagctacttaaagagtttaaagatgaagactggaatatgggcgacata
gtatacactctcacaaacaggcgctaccttgaaaagtgcattgcttatgcggagagccat
gatcaggcattggttggggataagacggtggcattttggttgatggatgctgaaatgtat
acaaatatgagtgtcctgagtccttttactccagttattgatcgtggaatacagcttcat
aaaatgattcgactcattactcatgggcttggtggggaaggctatctcaatttcatgggt
aatgaatttgggcatcctgaatggttagacttcccaagaaaaggaaataatgagagttac
cattatgccagacggcagtttcatttaactgatgatgaccttcttcgctacaagttccta
aataattttgacagggatatgaatagattggaagaaagatgtggttggctttcagctcca
caggcctatgtgagtgaaaaacatgaaggcaataagatcattgcttttgaaagagcaggt
cttcttttcattttcaacttccatccaagcaagagctacactgactaccgagttggaaca
gcattgccagggaaattcaaaattgtgctagattcagatgcagcggaatatggagggcat
cagagactggaccacagcactgactttttttctgaggcttttgaacataatgggcgtccc
tattctcttttggtgtacattccaagcagagtggcgctcatccttcagaacgtggatctg
ccgaattga

DBGET integrated database retrieval system