KEGG   Macaca fascicularis (crab-eating macaque): 101867124Help
Entry
101867124         CDS       T02918                                 

Definition
uncharacterized LOC101867124
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101867124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 611 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNAAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagaaagtgatggcacatcccgacgatctgct
cgagtcacccgctcctcagccaggctaagccagagttctcaagattccagtcctgttcga
aatttgcagtcttttggcactgaggagcctgcttactctaccagaagagtgacccgtagt
cagcagcagcctaccccagtgacaccgaaaaaatacccccttcggcagactcgttcatct
ggctcagaaactgagcaagtggttgatttttcagatagagaaactaaaaatgcagctgat
catgatgagtcaccacctcgaactccaactggaaacgcaccttcttctgagtcagacata
gacatctccagccccaatgtgtctcacgatgagagcattgccaaggacatgtccctgaag
gactcaggcagtgatctctctcatcgccccaagcgccgtcgcttccatgaaagctacaac
ttcaatatgaagtgtcctacaccaggctgtaactctctaggacaccttacaggaaaacat
gagagacatttctccatctcaggatgcccactctatcataacctctcagctgacgaatgc
aaggtgagagcacagagccgggataagcagatagaagaaaggatgctgtctcacaggcaa
gatgacaacaacaggcatgcaaccaggcaccaggcaccaacggagaggcagcttcgatac
aaggaaaaagtggctgaactcaggaagaaaagaaattctggactgagcaaagaacagaaa
gagaaatacatggaacacagacagacctatgggaacacacgggaacctctcttagaaaac
ctgacaagtgagtatgacttggatcttttccgaagagcacaagcccgggcttcagaggat
ttggagaaattaaggctgcaaggccaaatcacagagggaagcaacatgattaaaacaatt
gcttttggccgctatgagcttgatacctggtaccattctccatatcctgaagaatatgca
cggctgggacgtctctatatgtgtgaattctgtttaaaatatatgaagagccaaacgata
ctccgccggcacatggccaaatgtgtgtggaaacacccacctggtgatgagatatatcgc
aaaggttcaatctctgtgtttgaagtggatggcaagaaaaacaagatctactgccaaaac
ctgtgcctgttggccaaactttttctggaccataagacattatattatgatgtggaaccc
ttcctgttctatgttatgacagaggcggacaacactggctgtcacctgattggatatttt
tccaaggaaaagaattcattcctcaactacaacgtatcctgtatccttaccatgcctcag
tacatgagacagggctatggcaagatgcttattgatttcagttatttgctttccaaagtc
gaagaaaaagttggctccccagaacgtccactctcagatctggggcttataagctatcgc
agttactggaaagaagtacttctccgctacctgcataatttccaaggcaaagagatttct
atcaaagaaatcagtcaggagacggctgtgaatcctgtagacattgtcagcactctacaa
gcccttcagatgctcaagtactggaagggaaaacacctagttttaaagagacaggacctg
attgatgagtggatagccaaagaggccaaaaggtccaactccaataaaaccatggatccc
agctgcttaaaatggacccctcccaagggcacttaa

DBGET integrated database retrieval system