KEGG   Macaca fascicularis (crab-eating macaque): 101867136Help
Entry
101867136         CDS       T02918                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101867136
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101867136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 477 aa AA seqDB search
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVEGSERLGGWIRSVRGPNGAIFELGPRG
IRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSVLLGLLLGAGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQAL
ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA
PLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKELPSHCLVHLHKNCIP
QYTLGHWQKLESARQFLAAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgttgggcggaggcatcagcggcttggccgccagttaccac
ctgagccgggccccgtgtccccctaaggtggtcctggtggagggcagtgagcgtctggga
ggctggattcgctctgttcgaggcccgaatggtgctatctttgagcttggacctcgggga
attaggccagcgggagccctaggggcccggaccttgctcctggtttctgagcttggcttg
gattcagaagtgctgcctgtccggggagaccacccagctgcccagaacaggttcctctac
gtgggcggtgccctgcatgccctgcccactggcctcagggggctactccgcccttcaccc
cccttctccaaacctctgttttgggctgggctgagggagctgaccaagccccggggcaaa
gagcctgatgagaccgtgcacagttttgcccagcgccgccttggacctgaggtggcgtct
ctagccatggacagtctctgccgtggagtgtttgcaggcaacagccgtgagctcagcatc
aggtcctgttttcccagtctcttccaagctgagcaaacccatcgttccgtattactgggc
ctgctgctgggggcagggcggaccccacagccagactcagcactcattcgccaggccttg
gctgagcgctggagccagtggtcacttcgtggaggtctagagatgctgcctcaggccctt
gaaacccacctaactagtaggggggtcagtgttctcagaggtcagccagtctgtgggctc
agcctccaggcagaagggcgctggaaggtatctctaagggacagcagtctggaggctgac
cacgttattagtgccattccagcttcagtgcttagcgagctgctccctgctgaggctgca
cctctggctcgtgccctgagtgccatcactgcggtgtctgtagctgtggtgaatctgcag
taccaaggagcccatctgcctgtccagggatttggacacttggtgccatcttcagaagat
ccaggcgtcctgggaatcgtgtatgactcagttgctttccctgagcaggatgggagcccc
cctggcctcagagtgactgtgatgctgggaggttcctggttacagacactggaggcgagt
ggctgtgtcttatctcaggagctgtttcaacagcgggcccaggaagcagctgccacacaa
ttaggactgaaggagctgccaagtcactgcttggtccatctacacaagaactgcatcccc
cagtatacactaggtcactggcaaaaactagagtcagctaggcaattcctggctgctcac
aggttgcccctgactctggctggagcctcctatgagggggttgctgttaatgactgtata
gagagtgggcgccaggcagcagtcagtgtcttgggcacagaacctaacggctga

DBGET integrated database retrieval system