KEGG   Macaca fascicularis (crab-eating macaque): 101867495Help
Entry
101867495         CDS       T02918                                 

Gene name
JOSD1
Definition
(RefSeq) Josephin domain containing 1 (EC:3.4.19.12)
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101867495 (JOSD1)
Peptidases [BR:mcf01002]
 Cysteine Peptidases
  Family C86
   101867495 (JOSD1)
Ubiquitin system [BR:mcf04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    101867495 (JOSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 202 aa AA seqDB search
MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGK
NCELLLVVPEEVEAHQSWRTDV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtgtgccatggaaaggagacaaggccaaatctgaatcattggagctgccccag
gcagcacccccacaaatctaccatgagaaacagcgcagggagctttgtgccctccacgcc
ctcaataacgtcttccaggacagcaatgccttcacccgggatacgctgcaagagattttc
cagaggttgtctccaaacaccatggtgacacctcacaagaagagcatgctgggaaatggc
aactacgatgtgaatgtcattatggcagcacttcagaccaaaggctatgaagctgtttgg
tgggacaagcgcagggatgtcggtgtcattgccctcactaatgtcatgggcttcatcatg
aatctgccctccagcctatgctggggtccactgaaactgcccctcaaaaggcagcactgg
atctgtgtccgagaggtgggaggggcctactacaacctcgactccaaactcaagatgccg
gagtggattggaggcgagagcgagctcaggaagtttctaaaacatcatttgcgaggaaag
aactgtgaactcctgctggtggtaccagaagaggtagaggctcatcagagttggaggact
gacgtgtag

DBGET integrated database retrieval system