KEGG   Macaca fascicularis (crab-eating macaque): 101925100Help
Entry
101925100         CDS       T02918                                 

Definition
uncharacterized LOC101925100
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mcf00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mcf00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mcf00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mcf00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:mcf00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mcf00380]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:mcf00982]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:mcf04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mcf04726]
Human Diseases; Substance dependence; Cocaine addiction [PATH:mcf05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:mcf05031]
Human Diseases; Substance dependence; Alcoholism [PATH:mcf05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 520 aa AA seqDB search
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKVCWTESAKQLGTLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVQTLNHEIYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSPEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEVWQSEPESVDVPALPITTT
FLERYLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLMRV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaaatgcgacgtggtcgtggtggggggcggcatctcaggtatggcagcagcc
aaacttctgcatgactctggactgaatgtggttgttctggaagcccgggaccgtgtggga
ggcaggacttacactcttaggaaccaaaaggttaaatatgtggaccttggaggatcctat
gttggaccaacccagaatcgtatcttgagattagccaaggaattaggattggagacctac
aaagtgaatgaggttgagcgtctgatccaccatgtaaagggcaaatcataccccttcagg
gggccgttcccacctgtgtggaatccaattacctacttagatcataacaacttttggagg
acaatggatgatatggggcgagagattcccagtgatgccccatggaaggctccccttgca
gaagagtgggacaacatgacaatgaaggagctgctggacaaggtctgctggactgaatct
gcaaagcagcttggcactctctttgtgaacctgtgtgtcactgcagagacccatgaggtc
tctgctctctggttcctgtggtatgtgaagcagtgtggaggcacaaccagaatcatctcg
acaacgaatggaggacaggagaggaaatttgtgggcggatctggtcaagtgagcgagcgg
ataatggacctccttggagaccgagtgaagctggagaggcctgtgatctacattgaccag
acaagagaaaatgtccttgtgcagaccctaaaccatgagatatatgaggctaaatatgtg
attagtgctattcctcctactctgggcatgaagattcacttcaatccccctctgccaatg
atgagaaaccagatgatcactcgtgtgcctttgggttcagtcatcaagtgtatagtttat
tataaagagcctttctggaggaaaaaggattactgtggaaccatgattattgatggagag
gaagctccagttgcctacacattggatgataccaaacctgaaggcaactatgccgccata
atgggatttatcctagcccacaaagccagaaaactggcacgtctcaccaaagaggaaagg
ttgaagaaactttgtgaactctatgccaaggttctgggttccccagaagctctggagcca
gtgcattatgaagaaaagaactggtgtgaggagcagtactccgggggctgctacacaact
tacttcccccctgggatcctgactcaatatggaagggttctacgccagccagtggacagg
atttactttgcaggcaccgagactgccacacactggagcggctacatggagggggctgta
gaggctggggagagagcggcccgagagatcctgcatgccatggggaagattccagaggat
gaagtctggcagtcagaaccagagtctgtggacgtccctgcgctgcccatcaccacgacc
ttcttggagagatatttgccctccgtgccaggcctgctcaggctgattggattgaccacc
attttttcagcaacggctcttggcttcctggcccacaaaagggggctactcatgcgagtc
taa

DBGET integrated database retrieval system