KEGG   Macaca fascicularis (crab-eating macaque): 101925525Help
Entry
101925525         CDS       T02918                                 

Definition
uncharacterized LOC101925525
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101925525
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101925525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR
QQSSDLHSGSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG
ISLAQFMSPRRQVTSGLTTRPRMPNNSFPPNISTLSSPVGMTSSACNNNTNRSYSNIPVT
SLQGMNEGPNNSVGFSANSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSD
NSSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLS
CTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSV
SVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKE
QMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGA
VTSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAI
NQNKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDK
LVQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLG
TMPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQ
FAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQS
FGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLA
NRNSMVSRGMTGNMGGQFGTGINPQIQQNVFQYPGAGMVPQGEASFAPSLSPGSSMVPMP
IPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNVFSQAVQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcgccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttagaagaactagctgagttactgtctgccaacattagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgacgatgtacagaaatcagacatctca
tcaagtagtcaaggagtgatagaaaaggaatccttgggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgta
accagctacttaggttacaatcaggaggaattaatgaataccagcgtctacagcatactg
cacgtgggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaacagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggaaccgagaaccaagaagcttgccagcgttatgaagta
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtctgatttgtattgcacggcgattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctccattgatactagttccctg
agagctgctggcagaactggttgggaagatttagtgaggaagtgcatttacgcttttttc
caacctcagggcagagagccatcttatgccagacagctgttccaagaagtgatgactcgt
ggcactgcctccagcccctcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcagcctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaacccctcggtcaatcctagtatctctccagctcatggtgtg
gctcgttcatccacattgccaccatccaacagcaacatggtatccaccagaataaaccgc
cagcagagctcagaccttcatagcggcagtcatagtaattctagcaacagccaaggaagt
ttcggatgctcacctggaagtcagattgtagccaatgttgccttaaaccaaggacaggcc
agttcacagagcagtaatccctctttaaacctcaataattctcctatggaaggtacagga
atatccctagcacagttcatgtctccaaggagacaggttacttctggattgacaacaagg
cccagaatgccaaacaattcctttcctcctaatatttcgacattaagctctcctgttggc
atgacaagtagtgcctgtaataataatactaaccgatcttattcaaacatcccagtaaca
tctttacagggtatgaatgaaggacccaataactccgttggcttctctgccaattctcca
gtcctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaa
gctgagtccaaagataacaaagagattgcatccattttaaatgaaatgattcaatctgac
aacagctctagtgatggcaaacctctggattcagggcttctgcataacaatgacagactt
tcagatggagacagtaaatactctcaaaccagtcacaaactagtgcagcttttgacgaca
actgccgaacagcagttacggcatgctgatatagacacaagctgcaaagatgtcctgtct
tgcacaggcacttccaactctgcctctgctaactcttcaggaggttcttgtccctcctct
catagctcactgacagagcggcataaaattctgcaccggctcttacaggagggtagcccc
tcagatatcaccactttgtctgtcgagcctgataaaaaggacagtgcatctacttctgtg
tcagtgactggacaggtacaaggaaactccagtataaaactagagctggatgcttcaaag
aaaaaagaatcaaaagaccatcagctcctacgctatcttttagataaagatgagaaagat
ttaagatcaactccaaacctaagcctggatgatgtaaaggtgaaagtggaaaagaaagaa
cagatggatccttgtaatacaaacccaaccccaatgaccaaacccactcctgaggaaata
aaactggaggcccagagccagtttacagctgaccttgaccagtttgatcagttactgccc
acgctggagaaggcagcacagttgccaggcttatgtgagacagacaggatggatggtgcg
gtcaccagcgtaaccatcaaatcggagatcctgccagcttcacttcagtccgccactgcc
agacccacttccaggctaaatagattacctgagctggaattggaagcaattgataaccaa
tttggacaaccaggaacaggcgatcagattccatggacaaataatacagtgacagctata
aatcagaataaatcagaagaccagtgtattagctcacaattagatgagcttctctgtcca
cccacaacagtagaagggagaaatgatgagaaggctcttcttgaacagctggtatccttc
cttagtggcaaagatgaaactgagctagctgaactagacagagctctgggaattgacaaa
cttgttcaggggggcggattagatgtattatcagagagatttccaccacaacaagcaaca
ccacctttgatgatggaagaaagacccaacctttattcccagccttactcttctccttct
cctactgccaatctccctagccctttccaaggcatggtcaggcaaaaaccttcactgggg
acgatgcctgttcaagtaacacctccccgaggtgctttttcacctggcatgggcatgcag
cccaggcaaactctaaacagacctccggctgcacctaaccagcttcgacttcaactacaa
cagcgattacagggacaacagcagttgatacaccaaaatcggcaagctatcttaaaccag
tttgcagcaactgctcctgttggcatcaatatgagatcaggcatgcaacagcaaattaca
cctcagccacccctgaacgctcaaatgttggcacaacgtcagcgggaattgtacagtcaa
cagcaccgacagaggcagctaatacagcagcaaagagccatgcttatgaggcaacaaagc
tttgggaacaacctccctccctcatctggactaccagttcaaatggggaacccccgtctt
cctcagggtgctccacagcaattcccctatccaccaaactatggtacaaatccaggaacc
ccacctgcttctaccagcccgttttcacaactagcagcaaatcctgaagcatccttggcc
aaccgcaacagcatggtgagcagaggcatgacaggaaacatgggaggacagtttggcact
ggaatcaatcctcagatacagcagaatgtcttccagtatccaggagcaggaatggttccc
caaggtgaggccagctttgctccatctctaagccctgggagctccatggtgccgatgcca
atccctcctcctcagagctctctgctccagcaaactccgcctgcctccgggtatcagtca
ccagacatgaaggcctggcagcaaggagcaataggaaacaatgtgttcagtcaagctgtc
cagaaccagcccacacctgcacagccaggagtatacaacaacatgagcatcaccgtttcc
atggcaggtggaaatacgaatgttcagaacatgaacccaatgatggcccagatgcagatg
agctctttgcagatgccaggaatgaacactgtgtgccctgagcagataaacgatcccgca
ctgagacacacaggcctctactgcaaccagctctcatctactgaccttctcaaaacagaa
gcagatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaagccc
acgtcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system