KEGG   Macaca fascicularis (crab-eating macaque): 101925563Help
Entry
101925563         CDS       T02918                                 

Definition
hypothetical protein
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     101925563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 152 aa AA seqDB search
MALDKSVILLPLLVLVLLVLGCLGRESRAKKFQRQHMDSGSSPSSNSTYCNQMMKRRSMT
HGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQTNCFKSKSSMHITDCRLTNGSRYPNCA
YRTSPKERHIIVACEGSPHVPVHFDASVEDST
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggctctggataagtctgtcatcctgctccctctgcttgtcctggtgctgctggtgctg
ggctgcctgggcagggaatcccgggccaagaaattccagcggcagcacatggactcaggc
agttcccccagcagcaactccacctactgcaaccaaatgatgaagcgccggagtatgacg
cacgggcggtgcaaaccagtgaacacctttgtgcatgagcccctggtagatgtccagaat
gtctgcttccaggaaaaggtcacctgcaagaacgggcagaccaactgcttcaagagcaag
tccagcatgcacatcacagactgccgcctgacaaacggctccaggtaccccaactgtgca
taccggaccagcccgaaggagagacacatcattgtggcctgtgaagggagcccacatgtg
ccagtccacttcgatgcttctgtggaggactcaacctaa

DBGET integrated database retrieval system