KEGG   Macaca fascicularis (crab-eating macaque): 101926081Help
Entry
101926081         CDS       T02918                                 

Definition
uncharacterized LOC101926081
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101926081
   00330 Arginine and proline metabolism
    101926081
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101926081
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    101926081
  Nervous system
   04724 Glutamatergic synapse
    101926081
   04727 GABAergic synapse
    101926081
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101926081
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101926081
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 669 aa AA seqDB search
MMRLRGSAMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRSGGRPAVGPAAAARLHPWWGG
GGWPAGPLVRGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDSPGETDAFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
VHKNLDGLL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggcgatgctgcgggacctgctcctgcggtcgccagccggc
gtgagcgcgactctgcggcgggcacagcccctggtcaccctgtgccggcgtccccgaagc
gggggacggccggccgtgggcccagctgccgccgcgcgactccacccgtggtggggcggg
ggcggctggccggcggggccccttgtgcggggcctgtccagctctccctcggagatcttg
caggagctgggcaaggggagcacgcatccgcagcccggggtgtcgccacccgctgccccg
gcggcgcccggccccaaggacagccccggggagacggacgcgtttggcaacagcgagggc
aaagagctggtggcctcaggtgaaaataaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgcggaaggacaagagaaaatacccgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagatcttttt
aaaaaatgtgttcagagcaacattgttttgttgacacaagcctttagaagaaagtttgtc
attcctgactttatgtcttttacctcacacattgatgagttatatgaaagtgctaaaaag
cagtctggaggaaaggttgcagattatattcctcaactggccaaattcagtcctgatttg
tggggtgtgtctgtttgtacagtagatggacagaggcattctattggagataccaaagtt
cccttctgtcttcagtcctgtgtaaaacctttgaaatatgccattgctgttaatgatctt
ggaactgaatatgtgcatcgatatgttggaaaagagccgagtggactaagattcaacaaa
ctatttttgaatgaagatgataaaccacataatcctatggtaaatgctggagcaattgtt
gtgacttcactaataaagcaaggagtaaataatgctgaaaaatttgactatgtcatgcag
tttttgaataagatggctggtaatgaatatgttggattcagtaatgcgacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaagaagtgt
tttccagaaggcacagatatggttggtatattagacttctacttccagctgtgctccatt
gaagtgacttgtgaatcagccagtgtgatggctgcgacactggctaatggtggtttctgc
ccaattactggtgaaagagtactgagccctgaagcagttcgaaatactttgagtttgatg
cattcctgtggcatgtatgacttctcagggcagtttgcttttcatgttggtcttcctgca
aaatctggagttgctgggggcattcttttagttgtccccaatgttatgggtatgatgtgc
tggtctcctcctctggataagatgggcaacagtgttaagggaattcacttttgtcacgat
cttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaagggtaaagtcagtgataaatcttttgtttgct
gcatatactggagatgtgtctgcacttcgaagatttgctttgtcagctatggacatggaa
cagcgggactatgattctagaacagcactgcatgtagctgctgcagagggtcatgttgaa
gttgttaaatttttgctggaagcctgcaaagtaaaccctttccccaaggacaggtggaat
aacactcccatggatgaagcactgcactttggacaccatgatgtatttaaaattctccaa
gaataccaagtccagtacacacctcaaggagattctgacaacgggaaggaaaatcaaacc
gtccataagaatcttgatggattgttgtaa

DBGET integrated database retrieval system