KEGG   Macaca fascicularis (crab-eating macaque): 101926718Help
Entry
101926718         CDS       T02918                                 

Definition
uncharacterized LOC101926718
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     101926718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 109 aa AA seqDB search
MTKVLFIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFESYSLSDWLCLAFVESKFNIS
KINENADGSFDYGLFQINGHYWCNDYRSHSENLCQVDCQGLARAPGWER
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtgctattcatctacttggtcagcagctttcttgccctaaatcaggccagc
ctcatcagtcgctgtgacttggcccaggtgctgcagctggaggacttggatgggtttgag
agttactccctgagtgactggctgtgcctggcttttgtggaaagcaaattcaacatatca
aagataaatgagaacgcagatggaagctttgactatggcctcttccagatcaacggccac
tactggtgcaacgattataggagtcactcggaaaacctttgccaggtggactgtcaaggt
ctggccagggccccagggtgggagagatga

DBGET integrated database retrieval system