KEGG   Macaca fascicularis (crab-eating macaque): 102114823Help
Entry
102114823         CDS       T02918                                 

Gene name
COMT
Definition
(RefSeq) catechol-O-methyltransferase
  KO
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102114823 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    102114823 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102114823 (COMT)
Enzymes [BR:mcf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     102114823 (COMT)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102114823 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
10
AA seq 270 aa AA seqDB search
MLEAPPLLLAAVFLGLVLVVLLLILRRWGWGLCLICWNEFVLQPIRNLLMGDTKEQRILH
HVLQHAEPGNAQSVVEAIDTYCQQKEWAMNVGDKKGKIVDAVIQEHQPSMLLELGAYCGY
SAVRMARLLSPGARLLTIEINPDYAAITQRMVDFAGVQDKVTVVVGASQDIIPQLKKKYD
VDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRRSNRFEC
THYQSFLEYRKVVDGLEKAIYKGPGSEAQP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggccccgcctctgctgctggcggctgtgttcctgggcctggtgctggtggtg
ctgctgttgatcctgaggcgctggggctggggcctgtgccttatctgctggaacgagttc
gtcctgcagcccatccgcaacctgctcatgggtgacaccaaggagcagcgcatcctgcac
cacgtgctgcagcatgcggagcctgggaatgcacagagcgtggtggaggccatcgacacc
tactgccagcagaaggagtgggccatgaacgtgggtgacaagaaaggcaagatcgtggac
gccgtgattcaggagcaccagccctccatgctgctggagctgggggcctattgtggctac
tcagctgtgcgcatggcccgcctgctgtcaccgggtgcgaggctgctcaccatcgagatc
aaccctgactacgccgccatcacccagcggatggtggatttcgctggcgtgcaggacaag
gtcaccgttgtggttggggcgtcccaggacatcatcccccagctgaagaagaagtatgat
gtggacacgctggacatggtcttccttgaccactggaaggaccggtacctgccagacacg
cttctcctggaggaatgtggcctgctgaggaaggggacagtgctactggctgacaacgtg
atctgcccaggtgcaccagacttcctggcacacgtgcgcaggagcaaccgctttgagtgc
acacactaccagtcattcctggaatacaggaaggtggtggacggcctggagaaggccatc
tataagggcccaggcagtgaagcacagccctga

DBGET integrated database retrieval system