KEGG   Macaca fascicularis (crab-eating macaque): 102117015Help
Entry
102117015         CDS       T02918                                 

Gene name
GAD1
Definition
glutamate decarboxylase 1 (brain, 67kDa)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Type I diabetes mellitus
Module
GABA (gamma-Aminobutyrate) shunt
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mcf00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mcf00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mcf00410]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:mcf00430]
Organismal Systems; Nervous system; GABAergic synapse [PATH:mcf04727]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:mcf04940]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccatcttcgtctgcaacctcctcgaacgcgggagcggaccccaat
accactaacctgcgccccacaacgtacgatacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcttgcaaaggaccaacagcctggaagagaag
agtcgccttgtgagtgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagcgaccgggatgcccgcttccggcgcacagagacggacttctccaacctgtttgct
agagatctgcttccggctaagaacggggaggagcaaaccgtgcaattcctcctggaagtg
gtggacatactcctcaactatgtccgcaagacatttgatcgctccaccaaggtgctggac
ttccatcacccacaccagttgctggaaggcatggagggcttcaacttggagctctctgac
caccccgagtccctggagcagatcctggttgactgcagagacaccttgaagtatggggtt
cgcacaggtcatcctcgatttttcaaccagctctccactggattggatatcattggccta
gctggagaatggctgacatcaacagccaatactaatatgtttacatatgaaattgcacca
gtgtttgtcctcatggaacaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggcgccatatccaacatgtacagcatc
atggctgctcgctacaagtacttcccggaagttaagacaaagggcatggcggctgtgccc
aaactggtactcttcacttcagaacacagtcactattccataaagaaagctggggctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaaaataatt
ccagctgattttgaggcaaaaattcttgaagccaaacagaagggatatgttcccttttat
gtcaatgcaactgctggcacaactgtttatggagcttttgatccgatacaagagattgca
gatatatgtgagaaatacaacctttggctgcatgtagatgctgcctggggaggtgggctg
ctcatgtccaggaagcaccgccataaactcaatggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggtgtgctgttgcagtgctctgccattctcgtcaaagaa
aagggtatactccaaggatgcaaccagatgtgtgcaggatacctcttccaaccagacaag
cagtatgatgtctcctacgacaccggggacaaggcaattcagtgtggccgccacgtggat
atcttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaaccagatc
aacaaatgcctggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggttttcgatggtgagcctgagcacacaaacgtctgtttttggtatattccacaa
agcctcaggggtgtgccagacagccctcaacgacgggaaaagctacacaaggtggctcca
aaaatcaaagccctgatgatggagtcaggcacgaccatggttggctaccagccccagggg
gacaaggccaacttcttccggatggtcatctctaacccagccgctacccagtctgacatt
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system