KEGG   Macaca fascicularis (crab-eating macaque): 102117060Help
Entry
102117060         CDS       T02918                                 

Gene name
NEU3
Definition
sialidase 3 (membrane sialidase)
Orthology
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102117060 (NEU3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102117060 (NEU3)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102117060 (NEU3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 628 aa AA seqDB search
MLWTSGPFCRVPSEARNLCSTLRLSGEVLGGDTELQTNVRARGCGTEERKRPLGTEVGPG
LKLSWRGXRWCWSRAVVGTGLWAGGRGSAEGAGRXRARGGGQRLAPTATDYSLRPPXFVA
ITSFRQSTCSLLLGVCLRVLXLCFSLSILLCLRLRSLGAGASPRLRRMRPGDLPPRPMEE
PPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLA
FAEKRSTSRDEDALHLVLRRGLRIGHLVQWGPLKPLMEATLPGHRTMNPCPVWERKSGYV
FLFFICVRGHVTERQQIVSGRNAARLCFICSQDAGCSWSEVRDLTEEVIGSELKHWATFA
VGPGHGIQLQSGRLVIPAYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRP
MVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSQQLCEPPHGCQ
GSVVSFRPLEIPHRCQDSNSKDVPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKRR
VDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFR
LFTDREILSHLQGHCTSPGRNPSQFKSN
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgctctggacctctggtcctttttgtagggtaccctctgaggcccggaacctttgctca
actctcaggctgtccggggaagttttaggcggtgataccgagctgcagaccaatgtaaga
gctcggggctgtgggactgaagagaggaagcgaccgttgggaactgaggtgggcccaggg
cttaagctgagctggagagggtagaggtggtgctggtcccgtgcggtggtggggaccggg
ctgtgggctggagggaggggcagcgccgagggggcgggacggnggcgggctcgcggagga
ggccaacggttggccccaactgccactgactacagcctgcgtccgcctnctttcgttgcc
attacctctttccggcagtcgacctgctctttgcttctcggggtttgtctccgtgtcctc
nncctctgtttctccctctctatcctcctctgtctccgtctccgcagccttggggccggt
gcctctcccaggcttcggcgaatgagacctggggacttgcccccgcgccccatggaagaa
cccccggcgtccagctctgccccgacagagacggaggagccggggtccagtgcagaggtc
atggaagaagtgacaacatgctccttcaacagccctctgttccggcaggaagatgacaga
gggattacctaccggatcccagccctgctctacataccccccacccacaccttcctggcc
tttgcagagaagcgttccacgagcagggatgaggatgctctccacctggtgctgaggcga
gggttgaggattgggcacttggtacagtgggggcccctgaagccactgatggaagccaca
ctacctgggcatcggaccatgaacccctgtcctgtatgggaacggaagagtggttatgtg
ttcctgttcttcatctgtgtgcggggccatgtcacagagcgtcaacagattgtatcaggc
aggaatgctgcccgcctttgcttcatctgcagtcaggatgctggatgttcatggagtgag
gtgagggacttgactgaggaggtcattggctcagagctgaagcactgggccacatttgct
gtgggcccaggtcatggcatccagctgcagtcagggagactcgtcatccctgcatatacc
tactacatcccttcctggttcttttgcttccagctaccatgtaaaaccaggcctcattct
ctgatgatctatagtgatgacctaggggtcacatggcaccatgggagactcattaggcct
atggttacagtagaatgcgaagtggcagaggtgactgggagggctggccaccctgtgcta
tattgcagtgcccggacaccaaacaggtgccgggcagaggctctcagcactgaccatggt
gaaggctttcagaggctggccctgagtcaacagctctgtgagcccccacatggttgccaa
gggagtgtggtaagtttccggcccctggagatcccgcataggtgccaggactctaatagc
aaagatgtacccaccattcagcagagctctccaggtagttcactgaggctggaggaggaa
gctggaacaccgtcagaatcatggctcttgtactcacacccaaccagtaggaaacggagg
gttgacctaggaatctatctcaaccagacccccttggaggctgcctgctggtcccgcccc
tggatcttgcactgtgggccctgtggctactctgatctggctgctctggaggaggagggc
ttgtttgggtgtttatttgaatgtgggaccaagcaagagtgtgagcagattgccttccgc
ctgtttacagaccgggagatcctgagccacctgcaggggcactgcaccagccctggtagg
aacccgagccaattcaaaagcaattaa

DBGET integrated database retrieval system