KEGG   Macaca fascicularis (crab-eating macaque): 102117209Help
Entry
102117209         CDS       T02918                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102117209 (UCHL3)
Peptidases [BR:mcf01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102117209 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 294 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQAVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTESSSPSSSQPHSSHCRTKASSLC
HHASLPWVKRYHVGPAKATSPSLRLRRWRPFLRLPSLGLHSVAPNIDEKVDLHFIALVHV
DGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPEELRFNAIALSAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcaacgctggctgccgctggaggccaatcccgaggtcaccaaccagtttctc
aaacaattaggtctgcatcctaactggcaattcgtcgatgtatatggaatggatcctgaa
ctccttagcatggtaccaagaccagtctgcgcagtattacttctctttcctattacagaa
aagtatgaagtattcagaacagaagaggaagaaaaaataaaatctcagggacaagctgtt
acatcatcagtatatttcatgaagcaaacgatcagcaatgcctgtggaacaattggactg
attcatgctattgcaaacaataaagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctggaggaatctgtatcaatgagccctgaagaacgagccagatacctggagaac
tatgatgccatccgagttactcatgagaccagtgcccatgaaggtcagactgagtcctcc
tcgccatcctcatcacagcctcattctagccactgcagaacgaaggcctcatcattgtgt
caccatgcatccctgccctgggtcaaacgttaccatgtaggccctgcaaaggctaccagt
ccatctctccgtcttcgtcgctggcgacccttcttacgcctaccatctttgggtctccat
tctgttgcaccaaatatagatgaaaaagtagatcttcattttattgcattagttcatgta
gatgggcatctctatgaattagatgggcggaaaccatttccaattaaccatggtgaaact
agtgatgaaactttattagaggatgccatagaagtttgcaagaagtttatggagcgtgac
cctgaggaactaagatttaatgctattgctctttctgcagcatag

DBGET integrated database retrieval system