KEGG   Macaca fascicularis (crab-eating macaque): 102118475Help
Entry
102118475         CDS       T02918                                 

Definition
flocculation protein FLO11-like
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102118475
   00330 Arginine and proline metabolism
    102118475
   00340 Histidine metabolism
    102118475
   00350 Tyrosine metabolism
    102118475
   00360 Phenylalanine metabolism
    102118475
   00380 Tryptophan metabolism
    102118475
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102118475
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102118475
   04726 Serotonergic synapse
    102118475
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    102118475
   05031 Amphetamine addiction
    102118475
   05034 Alcoholism
    102118475
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102118475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 680 aa AA seqDB search
NRAPRLQWHRPATPSGQASSASRQVGREGGARPAYSHISPPLSGPGARGWPPRVGTGNSP
TGEGLREAEHRPQRPARSRNMSTNASASSPGGTGTGTGTTTGTGTTTGTGTTTGTGTTTG
TGTTTGTGTTTGTGTTTGTGTGTGREAEGPPEAGGTTSQVQNPASNLDDTSYNASEWSIR
SEWRSVSDPLASSQWSTSSTAEAASWTSSIPSRISTPGLSESMDSDSKSGLRDFSAYNPS
NRIPESTTRSNSSDVAATDSNQDTGIPWVLVTGPTPPINSPYESLQGSVFSSGFSPPQGS
VLSSVPGYTWIFVRGPPIPNDLSQVSIQAPPTPSNTPRVSVQGSATSSVPNFPWDLVPGP
PLPDNISPVSPQAPPAPHNIPQVSRQASTPTSVPHTPQGSIQEPPAPSNPFQLPTQGHSK
PNNSRRVSVQESAPLSVPSSPRVSAERSAPPLGAPGVSAKGFAPPTVPGSPRVSKEGSAP
PPGSPGELVEGSFPPFAVRTPVPPTQESVSSSMENQEKASIAGHMFDVVVIGGGISGLSA
AKLLTEYGVSVLVLEARDRVGGRTYTVRNEHVNYVDVGGAYVGPTQNRILRLSKELGIET
YKVNVCERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPADAPWEAQN
AAEWDKMTMKELIDKICWTK
NT seq 2044 nt NT seq  +upstreamnt  +downstreamnt
caaccgcgccccccgcctgcagtggcatcgcccggccacgcccagtggccaggcttccag
cgcgagcaggcaggtaggccgggaaggcggggccaggccggcgtacagccacatctcccc
gcccctgagtgggcccggcgcccggggctggcctccaagagtgggtaccgggaacagccc
gactggagaagggctgcgggaagcagaacaccgcccccagcgcccagcgcgctccagaaa
catgagcacaaacgcctcagcctcctcccccggcggcaccggcaccggcactggcaccac
taccggcactggcacgactaccggcactggcaccactaccggcactggcacgactaccgg
cactggcaccactaccggcactggcacaactaccggcactggcaccactaccggcactgg
caccggcaccgggcgcgaggcggagggcccgcccgaagccgggggcacaacttcccaggt
ccagaacccggcctccaacttggacgacacctcgtacaacgcgtccgaatggagcatccg
ttctgagtggcggtcggtctcggatccgctagccagttcccagtggagcacgtcctcaac
ggccgaggccgcctcctggacctccagcataccctcccgaatcagcacccccggtcttag
cgaaagtatggactccgactccaagagtggcctccgggatttcagcgcttacaacccgag
caatcggatccccgagtctaccacccgctcgaactcctccgatgtggccgccacagactc
caaccaggacaccggcattccctgggtattagtaacaggacctaccccgcccataaactc
cccctacgagtcattgcaagggtctgtcttctcctcagggttcagccccccacagggttc
ggtcctgagctcagtgcccggctacacttggatatttgtacggggacctcctatacccaa
tgacctttcgcaagtgtcaatacaagcacctcctacacccagtaacaccccccgagtgtc
agtacaagggtctgccacatcctcagtgcccaacttcccctgggatttggtaccaggacc
acctctgccggataacatctccccagtgtcgccacaagcacctcctgcaccccataacat
cccccaagtgtcaaggcaggcgtctacccccacctcagtgcctcacactccgcagggttc
aatacaagaacctcctgcacccagtaatcctttccaactgccgacacaaggacattctaa
acctaataactctcgcagagtgtcagtacaagagtccgccccgctctcagtgcccagctc
cccccgggtatcagctgaaagatcagctccgcccctgggcgctcccggagtatcagcaaa
agggttcgccccgcccacagtgcccggctccccccgggtatcaaaagaaggatcggctcc
gcccccgggctccccgggggagttggtagaagggtccttcccaccctttgccgtccgcac
tcctgtgcctccgacccaggagagtgtcagctcaagcatggagaatcaagagaaggcgag
tatcgcgggccacatgttcgacgtggtcgtgatcggaggtggcatttcaggactatctgc
tgccaaactcttgactgaatatggcgttagtgttttggttttagaagctcgggacagggt
tggaggaagaacatataccgtgaggaatgagcatgttaattacgtagatgttggtggagc
ttacgtgggaccaacccaaaacagaatcttacgcttgtctaaggagctgggcatagagac
ttacaaagtgaatgtctgtgagcgtctcgttcaatatgtcaaggggaaaacatatccatt
tcggggcgcctttccaccagtatggaatcccattgcatatttggattacaacaatctgtg
gcggacaatagataacatggggaaggagattccagctgatgcaccctgggaggctcaaaa
tgctgctgaatgggacaaaatgaccatgaaagagctcattgacaaaatctgctggacaaa
gtaa

DBGET integrated database retrieval system