KEGG   Macaca fascicularis (crab-eating macaque): 102119084Help
Entry
102119084         CDS       T02918                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102119084 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102119084 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    102119084 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    102119084 (MGLL)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102119084 (MGLL)
Peptidases [BR:mcf01002]
 Serine Peptidases
  Family S33
   102119084 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
11
AA seq 339 aa AA seqDB search
METGSEDPSRMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYEELAQMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD
YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKDYSGILKYSM
EKASRTLQFWIPNPFWVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAG
LKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMESAKSQDKTLKIY
EGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggatctgaagacccttccagaatgccagaggaaagttcccccaggcggacc
ccgcagagcattccctaccaggatctccctcacttggtcaatgcagatggacagtacctc
ttctgcaggtactggaaacccacaggcacacccaaggccctcatctttgtgtcccatgga
gctggagagcactgtggccgctatgaagagctggctcagatgctgatggggctggacctg
ctggtgttcgcccacgaccatgttggccacggacagagcgaaggggagaggatggtagtg
tctgacttccacgttttcgtcagagatgtgttgcagcatgtggattccatgcagaaagac
taccctgggcttcctgtcttccttctgggccactccatgggaggtgccatcgccatcctc
acggccgcagaaaggccgggccacttcgccggcatggtactcatttcacctctggttctt
gccaatcctgaatctgcaacaactttcaaggattattcggggattttgaaatattcgatg
gaaaaggcatcaagaacgttacagttttggattccaaatcctttttgggtccttgctgca
aaagtgctcaaccttgtgctgccaaacttgtccctcgggcccatcgactccagcgtgctc
tctcggaataagacagaggtcgacatttataactcagaccccttgatctgccgggcaggg
ctgaaggtgtgctttggcatccagctgctgaatgccgtctcacgggtggagcgcgccctc
cccaagctgacggtgcccttcctgctgctccagggctctgccgatcgcctgtgtgacagc
aaaggggcctacctgctcatggagtcagccaagagccaggacaagactctcaagatttat
gaaggtgcctaccacgttctccacaaagagcttcctgaagtcaccaactccgtcttccat
gaaataaacatgtgggtctctcaaaggacagccacggcaggaactgcgtccccaccctga

DBGET integrated database retrieval system