KEGG   Macaca fascicularis (crab-eating macaque): 102119346Help
Entry
102119346         CDS       T02918                                 

Definition
(RefSeq) cocaine esterase-like
  KO
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102119346
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     102119346
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     102119346
    3.1.1.84  cocaine esterase
     102119346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
20
AA seq 570 aa AA seqDB search
MRLHRLRARLSAVACGLLLLLVQGQGQDSASPIRTTHTGQVLGSLVHVKSADAGVHTFLG
IPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPDACLQDLTIMDSEVQSQVNVTIPSISMS
EDCLYLSIYTPAYSHKGSNLPVMVWIHGGGLVFGMASMYDGSVLAAFEDVVVVTIQYRLG
VLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSLVVS
PMSQGLFHGAIMESGVALLPGLIASSADVISTVVASLSACEQVDSEALVNCLRGKSKEEI
LAINKPFNMMIPGVVDGVFLPRHPQELLASADFQAVPSIIGINNDEFGWIIPKVTGIYDT
QKEMDREAFQAVLQKMLTLMMLPPTFGDLLMEEYNGDNGEPRSLQAQLQEMMADSMFVIP
ALQVAHFQRSRAPVYFYEFQHQPSWVKNIRPPHVKADHGDELPFVFGNFFWGNYVKFTEE
EERLSAQVWAPGAQNDLRIALLGRHVYRNPNGEGLPHWPLFHQEEQYLQLNLQPAVGRAL
KAHRFQFWKKALPQKKMQELKEPEEKHTEL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgcaccgacttcgcgcgcggctgagtgcggtggcctgtgggctcctgttgctt
ctcgtccagggccagggccaggattctgccagtcccatccggaccacacacacgggccag
gtgctggggagtcttgtccatgtgaagagcgctgatgcgggggtccataccttcctggga
attccctttgccaagccacctctaggtccgctgcgatttgcaccccctgaaccccctgaa
tcttggagtggtgtgagggatggaaccacccatccggatgcgtgtcttcaggacctcacc
ataatggattcagaggttcagagccaagtcaatgtgaccatcccttccatctccatgtcc
gaggactgcctgtacctcagcatctacacgccggcctacagccacaaaggctctaaccta
ccagtgatggtgtggatccacggtggtgggcttgtttttggcatggcttccatgtatgat
ggttccgtgctggccgcctttgaggatgtggtggtggtcaccatccagtaccgcctgggt
gtcctgggcttcttcagcactggagacaagcatgcaaccggcaactggggctacctggac
caagtggccgcactacgctgggtccagcagaatatcgcccactttggaggcaaccctgac
cgtgtcaccatttttggcgagtctgcgggtggcacgagtgtgtcttcacttgttgtgtcc
cccatgtcccaaggactcttccatggggccatcatggagagtggcgtggccctgctgcct
ggcctcattgccagctcagctgatgttatctccacggtggtggccagcctgtctgcttgt
gagcaagttgactctgaggccctggtgaactgcctgcggggcaagagtaaagaggagatt
cttgcaattaacaagccgttcaacatgatgatccctggtgtagtcgatggggtcttcctg
cccaggcatccccaggagctgctggcctctgccgactttcaagctgtccccagcatcatt
ggtatcaacaacgatgaattcggctggatcatccccaaagtcacgggtatctatgacacc
cagaaggaaatggacagagaggccttccaggctgttctgcagaaaatgttaacgctgatg
atgttgccgcctacatttggtgacctgctgatggaagagtacaatggggacaatggggaa
ccccggagcctccaagcccagttgcaggagatgatggcagactccatgtttgtgatccct
gcactccaagtagcacattttcagcgttcccgggcccctgtgtacttctatgagttccag
catcagcccagctgggtcaagaacatcaggccgccgcacgtgaaggcagaccatggtgat
gagcttccttttgttttcggaaatttcttctggggcaactatgttaaattcactgaggag
gaggagcggctaagtgctcaggtctgggctccaggggctcagaatgaccttcgtatcgcc
ctgctgggacggcatgtctacaggaaccccaatggcgagggtctgccacactggccgctg
ttccaccaggaggagcaatacctgcagctgaacctacagcctgcagtgggccgggctctg
aaggcccacaggttccagttctggaagaaggcgctgccccagaagaagatgcaggagctc
aaggagcctgaagagaaacacacagagctgtag

DBGET integrated database retrieval system