KEGG   Macaca fascicularis (crab-eating macaque): 102119346Help
Entry
102119346         CDS       T02918                                 

Definition
cocaine esterase-like
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Drug metabolism - other enzymes
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:mcf00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 654 aa AA seqDB search
MKGAFRPPCFCSSGSFTPIKFLPISPSVGILNSCQTHLFLAQASAARALFAQSKLRGWAR
PNPGQSLGEQRRVHRQRTETSEPTMRLHRLRARLSAVACGLLLLLVQGQGQDSASPIRTT
HTGQVLGSLVHVKSADAGVHTFLGIPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPDACL
QDLTIMDSEVQSQVNVTIPSISMSEDCLYLSIYTPAYSHKGSNLPVMVWIHGGGLVFGMA
SMYDGSVLAAFEDVVVVTIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFG
GNPDRVTIFGESAGGTSVSSLVVSPMSQGLFHGAIMESGVALLPGLIASSADVISTVVAS
LSACEQVDSEALVNCLRGKSKEEILAINKPFNMMIPGVVDGVFLPRHPQELLASADFQAV
PSIIGINNDEFGWIIPKVTGIYDTQKEMDREAFQAVLQKMLTLMMLPPTFGDLLMEEYNG
DNGEPRSLQAQLQEMMADSMFVIPALQVAHFQRSRAPVYFYEFQHQPSWVKNIRPPHVKA
DHGDELPFVFGNFFWGNYVKFTEEEERLSAQVWAPGAQNDLRIALLGRHVYRNPNGEGLP
HWPLFHQEEQYLQLNLQPAVGRALKAHRFQFWKKALPQKKMQELKEPEEKHTEL
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgccttcaggcctccctgcttttgctcaagcggttccttcaccccgatcaag
ttccttcccatttctccatctgtggggatcctgaactcctgccagacccaccttttcctg
gcccaagccagcgcagcccgcgcactctttgcccagtccaaactccgaggctgggcaagg
ccaaatccggggcagtctctgggtgaacagcggcgtgtccaccggcagcgaaccgagacc
agcgagccgaccatgcgactgcaccgacttcgcgcgcggctgagtgcggtggcctgtggg
ctcctgttgcttctcgtccagggccagggccaggattctgccagtcccatccggaccaca
cacacgggccaggtgctggggagtcttgtccatgtgaagagcgctgatgcgggggtccat
accttcctgggaattccctttgccaagccacctctaggtccgctgcgatttgcaccccct
gaaccccctgaatcttggagtggtgtgagggatggaaccacccatccggatgcgtgtctt
caggacctcaccataatggattcagaggttcagagccaagtcaatgtgaccatcccttcc
atctccatgtccgaggactgcctgtacctcagcatctacacgccggcctacagccacaaa
ggctctaacctaccagtgatggtgtggatccacggtggtgggcttgtttttggcatggct
tccatgtatgatggttccgtgctggccgcctttgaggatgtggtggtggtcaccatccag
taccgcctgggtgtcctgggcttcttcagcactggagacaagcatgcaaccggcaactgg
ggctacctggaccaagtggccgcactacgctgggtccagcagaatatcgcccactttgga
ggcaaccctgaccgtgtcaccatttttggcgagtctgcgggtggcacgagtgtgtcttca
cttgttgtgtcccccatgtcccaaggactcttccatggggccatcatggagagtggcgtg
gccctgctgcctggcctcattgccagctcagctgatgttatctccacggtggtggccagc
ctgtctgcttgtgagcaagttgactctgaggccctggtgaactgcctgcggggcaagagt
aaagaggagattcttgcaattaacaagccgttcaacatgatgatccctggtgtagtcgat
ggggtcttcctgcccaggcatccccaggagctgctggcctctgccgactttcaagctgtc
cccagcatcattggtatcaacaacgatgaattcggctggatcatccccaaagtcacgggt
atctatgacacccagaaggaaatggacagagaggccttccaggctgttctgcagaaaatg
ttaacgctgatgatgttgccgcctacatttggtgacctgctgatggaagagtacaatggg
gacaatggggaaccccggagcctccaagcccagttgcaggagatgatggcagactccatg
tttgtgatccctgcactccaagtagcacattttcagcgttcccgggcccctgtgtacttc
tatgagttccagcatcagcccagctgggtcaagaacatcaggccgccgcacgtgaaggca
gaccatggtgatgagcttccttttgttttcggaaatttcttctggggcaactatgttaaa
ttcactgaggaggaggagcggctaagtgctcaggtctgggctccaggggctcagaatgac
cttcgtatcgccctgctgggacggcatgtctacaggaaccccaatggcgagggtctgcca
cactggccgctgttccaccaggaggagcaatacctgcagctgaacctacagcctgcagtg
ggccgggctctgaaggcccacaggttccagttctggaagaaggcgctgccccagaagaag
atgcaggagctcaaggagcctgaagagaaacacacagagctgtag

DBGET integrated database retrieval system