KEGG   Macaca fascicularis (crab-eating macaque): 102120769Help
Entry
102120769         CDS       T02918                                 

Gene name
DHCR7
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    102120769 (DHCR7)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     102120769 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 475 aa AA seqDB search
MAAKSQPNVPKAKSVDSVTNDRTASQGQWGRAWEVDWFSLGSIIFLLLCAPFIVYYFIMA
CDQYSCALTGPVVDIATGRARLSDIWAKTPPITRKAAQLYTLWVTFQVLLYTSLPDFCHK
FLPGYVGGIQEGAVTPAGVVNKYQINGLQAWLLTHLLWFANAHLLSWFSPTIIFDNWIPL
LWCANILGYAVSTFAMVKGYFFPTSARDCKFTGNFFYNYMMGVEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQRELHGHVTNAMVLVNVLQAIYVIDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAVGVLLLGLVGYYIFRVANHQKDL
FRRTDGRCLIWGKKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMGSLAYCL
ACGGGHLLPYFYIIYMAILLTHRCLRDEHRCASKYGRDWERYTAAVPYRLLPGIF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaaatcgcaacccaacgttcccaaagccaagagtgtagacagcgtcaccaat
gacagaactgcatctcaagggcagtggggccgtgcctgggaggtggactggttttcactg
gggagcatcatcttcctactgctgtgcgcgcccttcatcgtctactacttcatcatggcg
tgtgaccagtacagctgcgccctgaccggccccgtggtggacatcgccaccgggcgtgct
cggctgtcagacatctgggccaagactccacctataacgaggaaagccgcccagctctat
accttgtgggtcaccttccaggtgcttctgtacacgtctctccctgacttctgccataag
tttctacccggctacgtaggaggcatccaggagggggccgtgacccctgcaggggttgtg
aacaagtatcagatcaacggcctgcaagcctggctcctcacacatctgctctggtttgca
aacgctcatctcctgtcctggttctcgcccaccatcatcttcgacaactggatcccattg
ctgtggtgcgccaacatccttggctatgccgtctccaccttcgccatggtcaagggctac
ttcttccccaccagcgccagagactgcaaattcacaggcaatttcttttacaactacatg
atgggcgtcgagtttaaccctcggatcgggaagtggtttgacttcaagctgttcttcaac
gggcgccccgggatcgtcgcctggacgctcatcaacctgtccttcgcagcaaagcagcgg
gagctccacggccacgtgaccaacgccatggtcctggtcaacgtcctgcaggccatctac
gtgattgacttcttctggaacgaaacctggtacctgaagaccattgacatctgccatgac
catttcgggtggtacctgggctggggcgactgtgtctggctgccttacctttacacgctg
cagggtctgtacttggtgtaccaccccgtacagctgtccaccccgcatgccgtgggcgtc
ctgctgctgggcctggtgggttactacatcttccgggtggccaaccaccagaaggacctc
ttccgccgcacggatgggcgctgcctcatctggggcaagaagccaaaggtcatcgagtgc
tcctacacgtccgcagacgggcagaggcaccacagcaagctgctggtgtcaggcttctgg
ggcgtggcccgccacttcaactacgtcggcgacctgatgggcagcctggcctactgcctg
gcctgcggcggcggccacctgctgccctacttctacatcatctacatggccatcctgctg
acccatcgctgcctccgggatgagcaccgctgcgccagcaagtacggccgggactgggag
cgttacaccgccgcggtgccttaccgcctgctgcctggaatcttctaa

DBGET integrated database retrieval system