KEGG   Macaca fascicularis (crab-eating macaque): 102121212Help
Entry
102121212         CDS       T02918                                 

Gene name
TYMP
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mcf00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:mcf00983]
Human Diseases; Cancers; Bladder cancer [PATH:mcf05219]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 482 aa AA seqDB search
MAASMTVGTGAPPAPGDLSGEGSQGLLDPSPEPKQLPELIRIKRDGGRLSEADIRGFVAA
VVNGSAQGAQIGAMLMAIRLQGMDLEETSVLTQALAQSGQQLEWPEAWHQQLVDKHSTGG
VGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVTQSPEQMQALLEQA
GCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVIDVKFGGAA
VFPNQEQARELARTLVGVGASLGLRVAAALTAMDKPLGRCVGNALEVEEALLCMDGAGPP
DLRDLVTTLGGALLWLSGHAGTQAQGADRVAAALDDGSALGRFERMLAAQGVDPGLARAL
CSGSPAERRQLLPRAQEQEELLAPADGTVELVRALPLALVLHELGAGRSRAGEPLRLGVG
AELLVDVGQRLRRGTPWLRVHRDGPALSGPQRRALQEALVLSDRAPFAPPSPFAELVLPP
QQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcgatgacggtgggaaccggagccccacctgcgcctggtgacctctccggg
gaagggagccagggacttctcgacccctcgccagagcccaagcagctcccggagctgatc
cgcataaagcgagacggaggccgcttgagcgaagcggacatcaggggcttcgtggccgct
gtggtgaacgggagtgcgcagggcgcacagatcggggccatgctgatggcgatccgactt
cagggcatggatctggaggagacctcggtgctgacccaggccctggcccagtcggggcag
cagctggagtggccagaggcctggcaccagcagcttgtggacaagcattccacagggggt
gtaggcgacaaggtcagcctggtcctcgcacctgccctggcggcgtgtggctgcaaggtg
ccaatgatcagcggacgtggtctggggcacacaggaggtaccttggataagctggaatct
attcctggattcaatgtcacccagagcccagagcagatgcaagcgctgctggagcaggcg
ggctgctgtatcgtgggtcagagtgagcagctggtccctgcagacggaatcctatatgca
gccagagatgtgacagccaccgtggacagcctgccactcatcacagcctccatcctcagt
aagaagctcgtggagggcctgtctgctctggtgatcgacgttaagttcggaggggccgcc
gtcttccccaatcaggagcaggcccgggagctggcaaggacgctggttggtgtgggagcc
agtctagggcttcgggtcgcggcagcgctgaccgccatggacaagcccctgggccgctgc
gtgggcaacgccctggaggtggaggaggcgctgctctgcatggacggcgcaggcccgcca
gacttaagggacctggtcaccacgctcgggggcgccctgctctggctcagcggacacgcg
gggactcaggcccagggcgctgaccgggtggctgcggcgctggacgacggctcggccctt
ggccgcttcgagcggatgctggcggcgcagggcgtggatcccggtctggcccgagccctg
tgctccgggagccccgcagagcgccggcagctgctgcctcgcgcccaggagcaggaggag
ctgctggcgcccgcggatggcaccgtggagctggtccgggcgctgccgctggcgctggtg
ctgcacgagctcggggctgggcgcagccgcgctggggagccgctccgcctgggggtgggc
gccgaactgctggtcgacgtgggtcagaggctgcgccgtgggacaccctggctccgcgtg
caccgggacggccccgcgcttagcggcccgcagcgccgcgccctgcaggaggcactcgta
ctctcggaccgcgcgcccttcgcgcccccctcgcccttcgccgagctcgttctgccgccg
cagcaataa

DBGET integrated database retrieval system