KEGG   Macaca fascicularis (crab-eating macaque): 102122035Help
Entry
102122035         CDS       T02918                                 

Gene name
UGT1A9, UGT1A1, UGT1A3, UGT1A6, UGT1A8
Definition
UDP glucuronosyltransferase 1 family, polypeptide A9
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102122035 (UGT1A9)
   00053 Ascorbate and aldarate metabolism
    102122035 (UGT1A9)
   00500 Starch and sucrose metabolism
    102122035 (UGT1A9)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102122035 (UGT1A9)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102122035 (UGT1A9)
   00860 Porphyrin and chlorophyll metabolism
    102122035 (UGT1A9)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102122035 (UGT1A9)
   00982 Drug metabolism - cytochrome P450
    102122035 (UGT1A9)
   00983 Drug metabolism - other enzymes
    102122035 (UGT1A9)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102122035 (UGT1A9)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102122035 (UGT1A9)
Glycosyltransferases [BR:mcf01003]
 Others
  Hydrophobic molecule
   102122035 (UGT1A9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 533 aa AA seqDB search
MAVESQGRHPLVLGLLLCVLGPVLCHAGKMLLIPVDGSHWLSMLGTIQQLQQRGHEIVVL
APDASLYIREGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLRRVIKTYKKIKKDS
AMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCGPIVAQYLSLPTVFFLNALPCSLE
SEATQCPNPFSYVPRPLSAHSDHMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQR
EVTVQNLLSSASVWLLRSDFVKDYPRPIMPNMAFIGGINCLHQSPLSQEFEAYINASGEH
GIVVFSLGSMVAEIPEKKAMAIADALGKIPQTVLWRYTGTPPSNLANNTILVKWLPQNDL
LGHPMTRAFITHAGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTS
EDLENALKAVINDKSYKENIMHLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHD
LTWYQYHSLDVIGFLLAIVLTVAFIAFKCCAYGYRKCFGKKGRVKKAHKSKTH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggagtcccaaggcagacatccacttgtcctgggcctgctgctgtgtgtgctg
ggcccagtgctgtgccatgctgggaagatgctgttgatcccagtggatggcagccactgg
ctgagcatgcttgggaccatccagcagctgcagcagaggggacatgaaatagttgtccta
gcacctgatgcctcattgtacatcagagagggagcattttacaccttgaagacgtaccct
gtgccattccaaagggaggatgtgaaagagtcttttgttagtcttgggcataatgttttt
gagaatgattctttcctgcggcgtgtgatcaaaacatacaagaaaataaaaaaggactct
gctatgcttttgtctggctgttcccacttactgcacaacaaggagctcatggcctccctt
gcggaaagcagctttgacgtcatgctgacagaccctttccttccttgtggccccatcgtg
gcccagtacctgtctctgcccactgtattcttcttgaatgcattgccatgcagcctggaa
tctgaggctacccagtgccccaacccattctcctacgtgcccaggcctctgtccgctcat
tcagatcacatgaccttcctgcagcgggtgaagaacatgctcattgccttttcacagaac
tttctgtgcgacgtggtttattccccatatgcaacccttgcctcggaattcctgcagaga
gaggtgactgtccagaacctattgagctctgcatctgtctggctgcttagaagtgacttt
gtgaaggattaccctaggcccatcatgcccaatatggctttcattggtggaatcaactgc
cttcaccaaagtccactatcccaggaatttgaagcctacattaatgcttctggagaacat
ggaattgtggttttctctttgggatcaatggtcgcagaaattccagagaagaaagctatg
gcaattgctgatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacc
ccaccatcgaatcttgcgaacaatacgatacttgttaagtggctaccccaaaacgatctt
cttggtcacccaatgacccgtgcctttatcacccatgctggttcccatggtatttatgaa
ggcatatgcaatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaat
gcaaagcgcatggagactaagggagctggagtgaccctgaatgttcttgaaatgacttct
gaagatttagaaaatgccctaaaagcagtcatcaatgacaaaagctacaaggagaacatc
atgcacctctccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttc
tgggtggagtttgtgatgagacacaagggcgcaccacacctgcgccccgcagcccacgac
ctcacctggtaccagtaccattccttggacgtgatcggtttcctcctggccatcgtgctg
acagtggccttcatcgcctttaaatgttgtgcctatggctaccggaaatgcttcgggaaa
aaagggcgagttaagaaagcccacaaatccaagacccattga

DBGET integrated database retrieval system