KEGG   Macaca fascicularis (crab-eating macaque): 102123184Help
Entry
102123184         CDS       T02918                                 

Gene name
RNASE2
Definition
ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     102123184 (RNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 160 aa AA seqDB search
MVPKLFTSPICLLLLLGLMGVEGSLHAKPGQFTWAQWFEIQHINMTSGQCTNAMLVINNY
QRRCKNQNTFLLTTFADVVHVCGNPSMPCPSNTSLNNCHHSGVQVPLIHCNLTTPSRRIS
NCRYTQTTANKYYIVACNNSDPVRDPPQYPVVPVHLDRVI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggttccaaaactgttcacttccccaatttgtctgcttcttctgttggggcttatgggt
gtggaaggctcacttcatgccaaacccggacaatttacctgggctcagtggtttgaaatc
cagcatataaatatgacctctggccaatgcaccaatgcaatgctggtaattaacaattat
caacggcgatgcaaaaatcaaaatacttttcttcttacaacttttgctgatgtagttcat
gtctgtggtaacccaagcatgccctgccctagcaacacaagtctcaacaattgtcatcat
agtggagtccaggtgcctttaatccactgtaacctcacaactccaagtcgaaggatttca
aattgcaggtatacacagacaacagcaaacaagtactacatagttgcatgtaacaacagc
gatccagtacgggaccctccacagtatccagtggttccagttcacttggatagagtcatc
taa

DBGET integrated database retrieval system