KEGG   Macaca fascicularis (crab-eating macaque): 102123184Help
Entry
102123184         CDS       T02918                                 

Gene name
RNASE2
Definition
(RefSeq) ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Organism
mcf  Macaca fascicularis (crab-eating macaque)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 160 aa AA seqDB search
MVPKLFTSPICLLLLLGLMGVEGSLHAKPGQFTWAQWFEIQHINMTSGQCTNAMLVINNY
QRRCKNQNTFLLTTFADVVHVCGNPSMPCPSNTSLNNCHHSGVQVPLIHCNLTTPSRRIS
NCRYTQTTANKYYIVACNNSDPVRDPPQYPVVPVHLDRVI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggttccaaaactgttcacttccccaatttgtctgcttcttctgttggggcttatgggt
gtggaaggctcacttcatgccaaacccggacaatttacctgggctcagtggtttgaaatc
cagcatataaatatgacctctggccaatgcaccaatgcaatgctggtaattaacaattat
caacggcgatgcaaaaatcaaaatacttttcttcttacaacttttgctgatgtagttcat
gtctgtggtaacccaagcatgccctgccctagcaacacaagtctcaacaattgtcatcat
agtggagtccaggtgcctttaatccactgtaacctcacaactccaagtcgaaggatttca
aattgcaggtatacacagacaacagcaaacaagtactacatagttgcatgtaacaacagc
gatccagtacgggaccctccacagtatccagtggttccagttcacttggatagagtcatc
taa

DBGET integrated database retrieval system