KEGG   Macaca fascicularis (crab-eating macaque): 102123935Help
Entry
102123935         CDS       T02918                                 

Definition
UDP-glucuronosyltransferase 2B19-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102123935
   00053 Ascorbate and aldarate metabolism
    102123935
   00500 Starch and sucrose metabolism
    102123935
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102123935
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102123935
   00860 Porphyrin and chlorophyll metabolism
    102123935
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102123935
   00982 Drug metabolism - cytochrome P450
    102123935
   00983 Drug metabolism - other enzymes
    102123935
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102123935
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102123935
Glycosyltransferases [BR:mcf01003]
 Others
  Hydrophobic molecule
   102123935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 528 aa AA seqDB search
MSMKWTSALLLIQLSCYLSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLAYST
SILPDPNNPSPLKFEICPTSLTETEFEDSVTQLVKRWSDIRKDTFWPHFLHIQEMMWTYG
DMIRKFCKDVVSNKKLMKKLQESRFDVVLADAISPCGELLAELLKIPFVYSLRFSPGYAL
EKHGGGFLFPPSYVPVTMSELRDQMTFMERVQNMIYMVYFDFWFQVWDIKNWDQFYSKVL
GRPTTLFEIMAKAEIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSG
DNGVVVFSLGSMVSNMSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTQLYKWLPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVRLDFDTM
SSTDLLNALKTVINDPIYKENAMKLSSIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVATVIFIITKCLFCVWKFVRTRKKGKRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggacttcagctcttctgctgatacagctgagctgttacttgagctct
gggagttgtggaaaggtgctggtgtggcccacagaattcagccattggatgaatataaag
acaattctggatgagcttgtccagagaggtcatgaggtgactgtactggcatattcaact
tccattcttcctgatcccaacaacccatctcctcttaaatttgaaatttgtcctacatct
ttaaccgaaactgagtttgaggatagcgtcacgcaactggttaagagatggtcagacatt
cgaaaagacacattttggccacattttttacacatacaagaaatgatgtggacatatggt
gacatgattagaaagttctgtaaagatgtggtttctaataagaaacttatgaagaaacta
caggagtcaagatttgatgttgttcttgcggatgctatttccccctgtggtgagctactg
gctgagctacttaaaataccctttgtgtacagcctccgcttctctcctggctacgcactt
gaaaagcatggtggagggtttctgttccctccttcctatgtacctgttactatgtcagaa
ttaagagatcaaatgactttcatggagagagtacaaaatatgatctatatggtttatttt
gacttttggttccaagtatgggatataaagaactgggatcagttttacagtaaagttcta
ggaagacccactacattatttgagataatggcaaaagctgaaatatggcttattcgaaac
tactgggattttcaatttcctcatccactcttaccaaatgttgagttcgttggaggactc
cactgcaaacctgccaaacccctacctaaggaaatggaagagttcgtccagagctctgga
gacaatggtgttgtggtgttttctctggggtccatggtcagtaacatgtcagaagaaagg
gccaacgtaattgcatcagcccttgccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggactcaatactcagctgtacaagtggctaccccagaat
gatcttcttggtcatccaaaaaccagagcttttataactcacggtggagccaatggcatc
tacgaggcaatctaccatggaatccctatggtgggcgttccattgtttgccgatcaacct
gataacattgctcacatgaaggccaaaggagcagctgttagactggacttcgacacaatg
tcgagtacagacttactcaatgcactgaagacagtaataaatgatcctatatataaagag
aatgctatgaaattatcaagcattcatcatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccataaaggagccaaacaccttcgggttgcagcc
catgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcctgt
gtggcaactgtgatattcatcatcacaaaatgtctgttttgtgtctggaagtttgttaga
acaagaaagaagggaaaaagagattaa

DBGET integrated database retrieval system