KEGG   Macaca fascicularis (crab-eating macaque): 102124679Help
Entry
102124679         CDS       T02918                                 

Gene name
TGM4
Definition
transglutaminase 4
Orthology
K05621  
transglutaminase 4 [EC:2.3.2.13]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 684 aa AA seqDB search
MMDASKELKVLLVDFLKQENAVSHHTWEFQTSNPVFRRGQVFHLRLVLNQPLQSYHELKL
EFSTGPNPSIAKHTLVVLDPRTPSDHHNWQATLQNESGKEVTVAVTSTPNAILGKYQLHV
KTGKHILKSEENILYLLCNPWCKEDTVFMPDEDERKEYILNDTGCHYVGAARSIKYKPWN
FGQFEKNVLDCCISLLTESSLKPTDRRDPVLVCRAMSAMINFEKGQGVLVGNWTGDYQDG
TAPYKWTGSAPILQQYYSTKQAVRFGQCWVFAGILTTVLRALGIPARSVTAFDSAHDTEK
NLTVDTYVNENGEKITNMSRDSVWNFHVWTDAWMKRPDLPKGYDGWQAVDATPQERSQGV
FCCGPSPLTAIRKGDIFIVYDTRFVFSEVNGDRLIWLVKMVNGQEELHIISMETTSIGKN
ISTKAVGQDRRRDITYEYKYPEGSPEERQVMDHAFLLLSSEREHRRPVKENFLHMSVQSD
DALLGNPVNFTVILKRKTAALQNVNISGSFELQLYTGKKVAKLCDLNKTSQIQGQVSEVT
LTLDSKTYINSLAILDDEPVIRGFIIAEIVESKEIMASEVFVSFQYPEFSVELPNTGRVG
QLLVCNCIFRNTLAIPLTDVKFSLESLGISSLQTSEHGTVQPGETIQSQIKCIPIKTGPK
KFIIKLSSKQVKEINAQKIVLITK
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgcatcaaaagagctgaaagttctcctcgttgacttcttgaagcaggagaac
gccgtttctcaccacacgtgggagttccaaacgagcaatcctgtgttccggcgagggcag
gtgtttcacctgcggctggtgctgaaccagcccctacaatcctaccacgaactgaaactg
gaattcagcacagggccaaatcctagcatcgccaaacacaccctggtggtgctcgacccg
aggacgccctcagaccaccacaactggcaggcaacccttcaaaatgagtctggcaaagag
gtcacagtggctgtcaccagcacccccaatgccatcctgggcaagtaccaactacatgtg
aaaactggaaaacacatccttaagtctgaagaaaacatcctataccttctctgcaaccca
tggtgtaaagaggacacggttttcatgcctgacgaggacgagcgcaaagagtacatcctc
aacgacacaggctgccattacgtgggggctgccagaagtatcaaatacaaaccctggaac
tttggtcagtttgagaaaaatgtcctggactgctgcatttccctgctgactgagagctcg
ctcaagcccacagataggagggatcctgtgctggtgtgcagggccatgtctgctatgata
aactttgagaaaggccaaggcgtgctcgttgggaactggactggggactaccaagatggc
acagccccatacaagtggacaggcagcgccccaatcctgcagcagtactacagcacgaag
caggctgtgcgtttcggccagtgctgggtattcgctgggatcctgactacagtgctgaga
gcgctgggcatcccagcacgcagcgtgacagcctttgattcagctcatgacactgaaaag
aacctcacggtggacacctatgtgaatgagaatggcgagaaaatcaccaatatgagccgc
gactctgtctggaatttccacgtgtggacggatgcctggatgaagcgaccggatctgccc
aagggctatgacggctggcaggctgtggatgcaacgccgcaggagcgcagccagggtgtc
ttctgctgtgggccatcgccactgaccgccatccgcaaaggtgacatctttattgtctat
gacaccagattcgtcttctcagaagtgaatggtgacaggctcatctggttggtgaagatg
gtgaatgggcaggaggagttacacataatttcaatggagaccacaagcatcgggaaaaac
atcagcaccaaggcagtgggccaagacaggcggagagatatcacctacgagtacaagtat
ccagaaggctcccctgaggagaggcaggtcatggatcatgccttcctccttctcagttct
gagagggagcacagacgacctgtaaaagagaactttcttcacatgtcggtacagtcagat
gatgcgctgctgggaaaccctgttaatttcaccgtgattctcaaaaggaagactgctgcc
ctacagaatgttaacatctcgggctcctttgaactacagttgtacaccggcaagaaggtg
gcaaaactgtgtgacctcaataagacctcgcagatccaaggtcaagtatcagaagtgact
ctgaccttggactccaagacctacatcaacagcctggctatattagatgatgagccagtt
atcagaggtttcatcattgcggaaattgtggagtctaaagaaatcatggcctctgaagta
ttcgtgtctttccagtaccctgagttctctgtagagttgcctaacacaggcagagttggc
cagctacttgtctgcaattgtatcttcaggaatactctggccatccctttgactgacgtt
aagttctctttggaaagcctgggcatctcctcactacagacctctgaacatgggacggtg
cagcctggtgagaccatccaatcccaaataaaatgcatcccaataaaaactggacccaag
aaatttatcatcaagttaagttccaaacaagtgaaagagattaacgctcagaagattgtt
ctcatcaccaagtag

DBGET integrated database retrieval system