KEGG   Macaca fascicularis (crab-eating macaque): 102124844Help
Entry
102124844         CDS       T02918                                 

Gene name
UGT2A3
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member A3
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00040  Pentose and glucuronate interconversions
mcf00053  Ascorbate and aldarate metabolism
mcf00140  Steroid hormone biosynthesis
mcf00830  Retinol metabolism
mcf00860  Porphyrin and chlorophyll metabolism
mcf00980  Metabolism of xenobiotics by cytochrome P450
mcf00982  Drug metabolism - cytochrome P450
mcf00983  Drug metabolism - other enzymes
mcf01100  Metabolic pathways
mcf05204  Chemical carcinogenesis
Module
mcf_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102124844 (UGT2A3)
   00053 Ascorbate and aldarate metabolism
    102124844 (UGT2A3)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102124844 (UGT2A3)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102124844 (UGT2A3)
   00860 Porphyrin and chlorophyll metabolism
    102124844 (UGT2A3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102124844 (UGT2A3)
   00982 Drug metabolism - cytochrome P450
    102124844 (UGT2A3)
   00983 Drug metabolism - other enzymes
    102124844 (UGT2A3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102124844 (UGT2A3)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102124844 (UGT2A3)
Glycosyltransferases [BR:mcf01003]
 Others
  Hydrophobic molecule
   102124844 (UGT2A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 102124844
NCBI-ProteinID: XP_005555222
Position
5
AA seq 527 aa AA seqDB search
MRSEKSALVFLLLQLFCAGCGFCGKVLVWPCDMSHWLNVKVILEELIVRGHEVTVLTHSK
SFLIDYRKPSALKFEVVHMPQDKTENKETFVDLALNVLPGLSTWQSVIKLNDFFVEIRGT
LKMMCESFIYNQTLMKKLQETNYDVMLIDPVIPCGDLMAELLAVPFVVTLRTSLGGNMER
SCGKLPAPLSYVPVPMTRLTDRMTFLERVKNSMLSVFFHFWIQDYDYDFWKEFYSKALGR
PTTLCETVGKAEIWLIRTYWDFEYPQPYQPNFEFVGGLHCKPAKPLPKEMENFVQSSGED
GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGTNTRLYDWIPQNDL
LGHPQTKAFITHGGMNGVYEAIYHGVPMVGVPIFGDQPDNIAHMKAKGAAVEINFKTMTS
EDLLRAVRTVITDSSYKENAMRLSRIHHDQSVKPLDRAVFWIEFVMRHKGAKHLRSAAHD
LNWFQHHSIDVIAFLLACVATAIFLFTRCFLFSCQNFNKTRKIEKRE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctgagaagtcagctttggtatttctgctcctgcagctcttctgtgctggctgt
ggattctgtgggaaggtcctggtgtggccctgtgacatgagccattggcttaatgtcaag
gtcattctagaggagctcatagtgaggggccatgaggtaacagtattgactcactcaaag
tcttttttaattgactacaggaagccttctgcactgaaatttgaggtggtccatatgcca
caggacaaaacagaaaacaaagaaacatttgttgacctagctctgaatgtcttgccaggc
ttatcaacctggcaatcagttataaaattaaatgatttttttgttgaaataagaggaact
ttaaaaatgatgtgtgagagctttatctacaatcagacacttatgaagaaacttcaggaa
accaactacgatgtaatgcttatagaccctgtgattccctgtggagacctgatggctgag
ttgcttgcagtcccttttgtggtcacacttagaacttctctaggaggcaatatggagcga
agctgtgggaaacttccagctccactttcctatgtacctgtacctatgacacgactaaca
gacagaatgacctttctggaaagagtgaaaaattcaatgctttcagttttcttccacttc
tggattcaggattatgactatgatttttggaaagagttttatagtaaggcattaggaagg
cccactacattatgtgagactgtgggaaaagctgagatatggctaatacgaacatattgg
gattttgaatatcctcaaccataccaacctaattttgagtttgtaggaggattacactgt
aaacctgccaaacctttgcctaaggaaatggaaaattttgtccagagttcaggggaagat
ggtattgtggtgttttctctggggtcactatttcaaaatgttacagaagaaaaggctaac
atcattgcttcagcccttgcccagatcccacagaaggtgttatggagatacaaaggaaaa
aaaccatccacattaggaaccaatactcgtctgtatgattggataccccagaatgatctt
cttggtcatccccaaaccaaagcttttatcactcatggtggaatgaatggggtctatgaa
gctatttaccatggtgtccctatggtgggagttcccatttttggtgatcagcctgataac
attgctcacatgaaggccaaaggagcagctgtagaaataaacttcaaaactatgacaagt
gaagatttactgagggctgtgagaacagtcattaccgattcctcttataaagagaatgct
atgagattatcaagaattcaccatgatcaaagtgtaaagcccctggatcgagcagtcttc
tggatcgagtttgtcatgcgccacaaaggagccaagcacctgcgatcagctgcccacgac
ctcaactggttccagcaccactctatagatgtgattgcattccttctggcctgtgtggca
actgctatattcttgttcacaagatgttttttattttcctgtcaaaattttaataaaact
agaaagatagaaaagagggaatag

DBGET integrated database retrieval system